(data stored in ACNUC30630 zone)

EMBL: CP001737.PE196

CP001737.PE196       Location/Qualifiers
FT   CDS             225775..226728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0201"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: mxa:MXAN_7405
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76634"
FT                   /db_xref="GOA:C8XJV1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV1"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ACV76634.1"
FT                   /translation="MFLLRKPILALSGNTAVRDALTSTSLTASVVDRFIAGETTADAVA
FT                   AVSRLRPDGLQVSLDHLGEDTTDRATADATVEAYLQLIEALAAAGQVAGAELSVKLSAV
FT                   GQALIASPDLPAGGNAYALAGARRITDAAYAAGARVNLDMEDHTTVDQTLEVLFELRRA
FT                   HPDVGVAIQAMLLRTPKDLAELTGPGSRVRLVKGAYHEPAEVAYTDPAQIDLAYVRAMK
FT                   LLMHGKGYPMIASHDPRLVAIADRLAADAGRSPDRWEHQMLYGIRPDEQRRLVAAGKQV
FT                   RVYVPYGSDWYGYFTRRLAERPANLLFFLRSLTSKG"
     MFLLRKPILA LSGNTAVRDA LTSTSLTASV VDRFIAGETT ADAVAAVSRL RPDGLQVSLD        60
     HLGEDTTDRA TADATVEAYL QLIEALAAAG QVAGAELSVK LSAVGQALIA SPDLPAGGNA       120
     YALAGARRIT DAAYAAGARV NLDMEDHTTV DQTLEVLFEL RRAHPDVGVA IQAMLLRTPK       180
     DLAELTGPGS RVRLVKGAYH EPAEVAYTDP AQIDLAYVRA MKLLMHGKGY PMIASHDPRL       240
     VAIADRLAAD AGRSPDRWEH QMLYGIRPDE QRRLVAAGKQ VRVYVPYGSD WYGYFTRRLA       300
     ERPANLLFFL RSLTSKG                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page