(data stored in ACNUC30630 zone)

EMBL: CP001737.PE197

CP001737.PE197       Location/Qualifiers
FT   CDS             226787..228415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0202"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   scl:sce4459 1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76635"
FT                   /db_xref="GOA:C8XJV2"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV2"
FT                   /inference="protein motif:TFAM:TIGR01236"
FT                   /protein_id="ACV76635.1"
FT                   /translation="MDAVTHPPLPVNEPVLNYAPGSPERATLLEALAGFTGPMELGAVI
FT                   DGAVREPGGAPFTVVAPFDHGRVLGTSAHAVQDDARAAVAAALAAAADWRAMDFDSRAA
FT                   ILLRAADLLVGPWRARINAATMLGQAKTAYQAEIDSACELADFWRFNVHFARQILAEQP
FT                   IANAAGIWNRTDHRPLEGFVYAVTPFNFTAIAGNLPTAPALMGNVVVWKPSTTQQLAAS
FT                   LTMQLLIEAGLPPGVINMLPGTGPEISEVVLAHPELAGIHFTGSTRVFQQLWSAVGANI
FT                   GGYRSYPRLVGETGGKDFVVAHPSADVDVLRTALVRGAFEYSGQKCSAASRAYLPASLW
FT                   PALKDGLIEQTEALTVGSVEDLTNFTSAVIDDRSFGRLKAAIDRAHATDSVTVLAGGRY
FT                   DDAQGYFVRPTLLLGTDPRDEAFCTEYFGPILSLYVYPDAEFDAVLREVDQASPYALTG
FT                   SIIARDRAAVARASAALRYTAGNFYINDKPTGAVVGQQPFGGARASGTNDKAGSAANLL
FT                   RWTSPRSIKETFVAPTAVGYPHQAQ"
     MDAVTHPPLP VNEPVLNYAP GSPERATLLE ALAGFTGPME LGAVIDGAVR EPGGAPFTVV        60
     APFDHGRVLG TSAHAVQDDA RAAVAAALAA AADWRAMDFD SRAAILLRAA DLLVGPWRAR       120
     INAATMLGQA KTAYQAEIDS ACELADFWRF NVHFARQILA EQPIANAAGI WNRTDHRPLE       180
     GFVYAVTPFN FTAIAGNLPT APALMGNVVV WKPSTTQQLA ASLTMQLLIE AGLPPGVINM       240
     LPGTGPEISE VVLAHPELAG IHFTGSTRVF QQLWSAVGAN IGGYRSYPRL VGETGGKDFV       300
     VAHPSADVDV LRTALVRGAF EYSGQKCSAA SRAYLPASLW PALKDGLIEQ TEALTVGSVE       360
     DLTNFTSAVI DDRSFGRLKA AIDRAHATDS VTVLAGGRYD DAQGYFVRPT LLLGTDPRDE       420
     AFCTEYFGPI LSLYVYPDAE FDAVLREVDQ ASPYALTGSI IARDRAAVAR ASAALRYTAG       480
     NFYINDKPTG AVVGQQPFGG ARASGTNDKA GSAANLLRWT SPRSIKETFV APTAVGYPHQ       540
     AQ                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page