(data stored in ACNUC30630 zone)

EMBL: CP001737.PE200

CP001737.PE200       Location/Qualifiers
FT   CDS             complement(232640..233350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76638"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76638.1"
FT                   /translation="MRQGGVLGHYLDPASGARFVYARPEDQPELWNAYLDGAAENYRRF
FT                   GVEHVLEYDDIRTGAGTTLFVAVLDRSGQVVAGVRAQGPYTDVDDAHALMEWAGRPGTA
FT                   ALREGISARIDEGLLELKAGWVSADSPDRHALTPALARTVFHIFRLIGVRYALCTVADH
FT                   AVRRWQSSGAQIGQDVAPVAYPDPRYRTVPIWWDRETMLAASDASHLLLLAHEQEMFEL
FT                   SLNPDVRPGTPAAA"
     MRQGGVLGHY LDPASGARFV YARPEDQPEL WNAYLDGAAE NYRRFGVEHV LEYDDIRTGA        60
     GTTLFVAVLD RSGQVVAGVR AQGPYTDVDD AHALMEWAGR PGTAALREGI SARIDEGLLE       120
     LKAGWVSADS PDRHALTPAL ARTVFHIFRL IGVRYALCTV ADHAVRRWQS SGAQIGQDVA       180
     PVAYPDPRYR TVPIWWDRET MLAASDASHL LLLAHEQEMF ELSLNPDVRP GTPAAA           236
//

If you have problems or comments...

PBIL Back to PBIL home page