(data stored in ACNUC30630 zone)

EMBL: CP001737.PE213

CP001737.PE213       Location/Qualifiers
FT   CDS             246495..247439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0218"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ank:AnaeK_2061 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76651"
FT                   /db_xref="GOA:C8XJW8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW8"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACV76651.1"
FT                   /translation="MGQRESTGRQRWAYLGPEGTFTEQASRALAERLTGPIDLAPAGSV
FT                   SLALDEVRTGRADAACVAMESSVEGAVPVTQDELTHGEPLLITAEAYVPVTFDLLVRPG
FT                   TDRSAIRTVGAHPHGHAQIRGWLAAELPAAEAVMTASNAAAAAAVAAGELDAAAAAPVA
FT                   GSRYGLQTLVADVGEVRDAVTRFVLLRRPDRPPAPTGNDRTSLVLSVGNHPGSLLTVLG
FT                   EFASRGINLTRLESRPTRSRMGVYYFLVDADGHLNDPAMADVVAALIRRQALLRWLGSY
FT                   PRAAGVNEVTADFATPDAYRQADDQVRRWQRGG"
     MGQRESTGRQ RWAYLGPEGT FTEQASRALA ERLTGPIDLA PAGSVSLALD EVRTGRADAA        60
     CVAMESSVEG AVPVTQDELT HGEPLLITAE AYVPVTFDLL VRPGTDRSAI RTVGAHPHGH       120
     AQIRGWLAAE LPAAEAVMTA SNAAAAAAVA AGELDAAAAA PVAGSRYGLQ TLVADVGEVR       180
     DAVTRFVLLR RPDRPPAPTG NDRTSLVLSV GNHPGSLLTV LGEFASRGIN LTRLESRPTR       240
     SRMGVYYFLV DADGHLNDPA MADVVAALIR RQALLRWLGS YPRAAGVNEV TADFATPDAY       300
     RQADDQVRRW QRGG                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page