(data stored in ACNUC30630 zone)

EMBL: CP001737.PE214

CP001737.PE214       Location/Qualifiers
FT   CDS             247441..248157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0219"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bmj:BMULJ_00540
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76652"
FT                   /db_xref="GOA:C8XJW9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW9"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACV76652.1"
FT                   /translation="MRLLLIRHGQTPSNVLGLLDTAPPGPGLTDLGVAQAAALPATLAG
FT                   ERIDLIAASTQPRAQLTAAPLAAERGLTVLVRDGLCEVPAGELEMRGDEPAVRTYLTTV
FT                   REWMSGNLDVPMPGGPSGHQVLSRFDAVVQEVTAVVADRVGDDGTVALFAHGAMLRTWA
FT                   TARGTDAQQRQDLLARFQPLHNTGMIVVNGSADGWRIQTWAGQALGGPRLDDAPADGPA
FT                   GGDPTGSGIPSDYSPR"
     MRLLLIRHGQ TPSNVLGLLD TAPPGPGLTD LGVAQAAALP ATLAGERIDL IAASTQPRAQ        60
     LTAAPLAAER GLTVLVRDGL CEVPAGELEM RGDEPAVRTY LTTVREWMSG NLDVPMPGGP       120
     SGHQVLSRFD AVVQEVTAVV ADRVGDDGTV ALFAHGAMLR TWATARGTDA QQRQDLLARF       180
     QPLHNTGMIV VNGSADGWRI QTWAGQALGG PRLDDAPADG PAGGDPTGSG IPSDYSPR         238
//

If you have problems or comments...

PBIL Back to PBIL home page