(data stored in ACNUC30630 zone)

EMBL: CP001737.PE218

CP001737.PE218       Location/Qualifiers
FT   CDS             complement(251823..252776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0223"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mes:Meso_0836 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76656"
FT                   /db_xref="GOA:C8XJX3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX3"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACV76656.1"
FT                   /translation="MPTIAVVGEVVADAVLPPDGISAGVAHLTVHPGGGPANTAVALSR
FT                   LGSTARFAARISGGALGALCRAKLEESLVDLSASESASEPATLAIARLDATGAASYEFY
FT                   TDGTADWAWTDASLARLIDGPFTTHPAPVAVHTGSLALALQPSGQVIENLLARARPQMT
FT                   VSVDPNLRPLLVPVTSYRLWIDRWASLADIVRLSEDDLDLLWPGWTPEQAALHLHACGV
FT                   PLAVVSLGGDGAFASLRGEQLRVPIAPTTLVDTVGAGDSFHGGLLHHLAEAGQLGGRLD
FT                   TLTVDGLRDALTFASRVSAINCSRAGANPPWARELA"
     MPTIAVVGEV VADAVLPPDG ISAGVAHLTV HPGGGPANTA VALSRLGSTA RFAARISGGA        60
     LGALCRAKLE ESLVDLSASE SASEPATLAI ARLDATGAAS YEFYTDGTAD WAWTDASLAR       120
     LIDGPFTTHP APVAVHTGSL ALALQPSGQV IENLLARARP QMTVSVDPNL RPLLVPVTSY       180
     RLWIDRWASL ADIVRLSEDD LDLLWPGWTP EQAALHLHAC GVPLAVVSLG GDGAFASLRG       240
     EQLRVPIAPT TLVDTVGAGD SFHGGLLHHL AEAGQLGGRL DTLTVDGLRD ALTFASRVSA       300
     INCSRAGANP PWARELA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page