(data stored in ACNUC30630 zone)

EMBL: CP001737.PE22

CP001737.PE22        Location/Qualifiers
FT   CDS             26368..26676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76460"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76460.1"
FT                   /translation="MTTTAIRVILPAHLRELAHVHGEVELDVDGPVTQRSVLDALEAQL
FT                   PVLVGRVRDHQTQQRRGFVRFYACQEDLSHEPPDDPLPAAVAQGQEPFMIVGAMAGG"
     MTTTAIRVIL PAHLRELAHV HGEVELDVDG PVTQRSVLDA LEAQLPVLVG RVRDHQTQQR        60
     RGFVRFYACQ EDLSHEPPDD PLPAAVAQGQ EPFMIVGAMA GG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page