(data stored in ACNUC30630 zone)

EMBL: CP001737.PE222

CP001737.PE222       Location/Qualifiers
FT   CDS             259089..259568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_00775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76660"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX7"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00775"
FT                   /protein_id="ACV76660.1"
FT                   /translation="MTLSTQTMTDEQRKALILEYFNTFDRGGIRSTGEPILSLFADDCM
FT                   VWFPKWGLAKGVDEVGQMFADLGSTFEWIDHTTSHLNFVFSGGTTVAVEGLTRGRHRDG
FT                   DWQAGRPQWGAGRFCNIFEIWDMKIQRLHIYLDPDYAGRDTDRYPWLARELSAAR"
     MTLSTQTMTD EQRKALILEY FNTFDRGGIR STGEPILSLF ADDCMVWFPK WGLAKGVDEV        60
     GQMFADLGST FEWIDHTTSH LNFVFSGGTT VAVEGLTRGR HRDGDWQAGR PQWGAGRFCN       120
     IFEIWDMKIQ RLHIYLDPDY AGRDTDRYPW LARELSAAR                              159
//

If you have problems or comments...

PBIL Back to PBIL home page