(data stored in ACNUC30630 zone)

EMBL: CP001737.PE230

CP001737.PE230       Location/Qualifiers
FT   CDS             266987..267328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0237"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="TIGRFAM: hydroxyisourate hydrolase; PFAM:
FT                   Transthyretin; KEGG: sew:SeSA_A1161 hydroxyisourate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76668"
FT                   /db_xref="GOA:C8XJY5"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY5"
FT                   /inference="protein motif:TFAM:TIGR02962"
FT                   /protein_id="ACV76668.1"
FT                   /translation="MTIVRLSTHVLDTTVGRPAGGIPANLESLTPEGVSEVGRGRTDDD
FT                   GRVFQLNATGLAPGRYRLTLETEDYFRARHGAVFYPSIAVSFELSGDRDHYHIAVLTST
FT                   YSYSTYLGS"
     MTIVRLSTHV LDTTVGRPAG GIPANLESLT PEGVSEVGRG RTDDDGRVFQ LNATGLAPGR        60
     YRLTLETEDY FRARHGAVFY PSIAVSFELS GDRDHYHIAV LTSTYSYSTY LGS              113
//

If you have problems or comments...

PBIL Back to PBIL home page