(data stored in ACNUC30630 zone)

EMBL: CP001737.PE252

CP001737.PE252       Location/Qualifiers
FT   CDS             complement(291570..292931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0260"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   ppg:PputGB1_3262 hydroxydechloroatrazine
FT                   ethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76690"
FT                   /db_xref="GOA:C8XK07"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK07"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACV76690.1"
FT                   /translation="MTTLVLQGAHVATVDGSATEYRNGHVVVTDGLITAVGNGPAVPGA
FT                   ADARILDATGCLITPGFVNTHHHLYQWITRGLAVDDTLFGWLTTLYPVWGQIDAELVNV
FT                   AATGGLSWLAGTGCTTTTDHHYVFPRDGGDVLKAEIDAAARVGLRFHPTRGSMDLGRSK
FT                   GGLPPDNVVEDIDAILAATEEAIDTHHDPSFGSMLRIGVAPCSPFSVTGDLLRQTAELS
FT                   RRKGVRMHTHLCETLDEEQYCQEHFGCSPVEYMESVGWLGPEVWLAHSVWLTDDSIASL
FT                   ARTGTSVAHCPTSNARLGSGIARARDLRDAGVAVGLGVDGAASNEACALLEEARHALLF
FT                   ARAKGGPQALTVRDALDMATMGGARVLGRQDEIGSLEVGKLADIAVWRLDTLPHIDIVD
FT                   PIAALVLGAPPPLELLLVGGRPIVEQGRLSTVDTDRYATEVRDASKKLLARAGI"
     MTTLVLQGAH VATVDGSATE YRNGHVVVTD GLITAVGNGP AVPGAADARI LDATGCLITP        60
     GFVNTHHHLY QWITRGLAVD DTLFGWLTTL YPVWGQIDAE LVNVAATGGL SWLAGTGCTT       120
     TTDHHYVFPR DGGDVLKAEI DAAARVGLRF HPTRGSMDLG RSKGGLPPDN VVEDIDAILA       180
     ATEEAIDTHH DPSFGSMLRI GVAPCSPFSV TGDLLRQTAE LSRRKGVRMH THLCETLDEE       240
     QYCQEHFGCS PVEYMESVGW LGPEVWLAHS VWLTDDSIAS LARTGTSVAH CPTSNARLGS       300
     GIARARDLRD AGVAVGLGVD GAASNEACAL LEEARHALLF ARAKGGPQAL TVRDALDMAT       360
     MGGARVLGRQ DEIGSLEVGK LADIAVWRLD TLPHIDIVDP IAALVLGAPP PLELLLVGGR       420
     PIVEQGRLST VDTDRYATEV RDASKKLLAR AGI                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page