(data stored in ACNUC30630 zone)

EMBL: CP001737.PE261

CP001737.PE261       Location/Qualifiers
FT   CDS             302191..302526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0269"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: mch:Mchl_1356 urease, gamma subunit; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76699"
FT                   /db_xref="GOA:C8XK16"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK16"
FT                   /inference="protein motif:TFAM:TIGR00192"
FT                   /protein_id="ACV76699.1"
FT                   /translation="MAAGSTSGPGAIRTAPGFIELNANRSAAERIELVIVNTGDRPVQI
FT                   GSHVHLPDVNGALDFDRVAARGFRLDIPAGTSRRFEPGASRSVSAVALQGRRQVPGIAI
FT                   KSTPGEL"
     MAAGSTSGPG AIRTAPGFIE LNANRSAAER IELVIVNTGD RPVQIGSHVH LPDVNGALDF        60
     DRVAARGFRL DIPAGTSRRF EPGASRSVSA VALQGRRQVP GIAIKSTPGE L                111
//

If you have problems or comments...

PBIL Back to PBIL home page