(data stored in ACNUC30630 zone)

EMBL: CP001737.PE262

CP001737.PE262       Location/Qualifiers
FT   CDS             302527..304230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0270"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: xau:Xaut_4156 urease subunit alpha; TIGRFAM:
FT                   urease, alpha subunit; PFAM: amidohydrolase; Urease
FT                   alpha-subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76700"
FT                   /db_xref="GOA:C8XK17"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK17"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACV76700.1"
FT                   /translation="MVQISRADYAALYGPTVGDQVRLGDTDLWIEIEQDYTAGGEEAVF
FT                   GGGKSIRESMAQGSTTRAQGAPDTVITNAIILDHWGIVRADVGIRDGRIVAIGRAGNPD
FT                   IADGVHPDLQIGPSTDIISGEGKILTAGGIDTHVHLISPSQIVEALATGLTTLGGGGTG
FT                   PSEGTKATTVTPGAWHLETIHRSIDPYPINLLLLGKGNTVSMAGLKEQALAGAGGYKVH
FT                   EDWGSTPAAIDAALRAADEWGLQVALHSDSLNESGYVASTIAAIGGRSISAFHVEGAGG
FT                   GHAPDILTLAGLPNVIPGSTNPTLPHTVNTVAEHLDMLMVCHHLNPAVPEDLAFAESRI
FT                   RATTIAAEDILHDMGAVSLTSSDAQAMGRIGEVVCRTWQVAHVMKNRRGDIGGGLPADN
FT                   FRARRYIAKYTINPAITHGIDHEVGSVEPGKLADLVLWEPKFFGIRPAVVLKGGGLVWG
FT                   ALGDPNASIPTPQPVLMRPALTDAIGAQLSLSFVSPFALEDGLADRLGLRRKLSAVKPT
FT                   RDVGKAQMINNDALPDIVIKPDTFEISIDGEVVVPAPAQRLPLAQLYSLF"
     MVQISRADYA ALYGPTVGDQ VRLGDTDLWI EIEQDYTAGG EEAVFGGGKS IRESMAQGST        60
     TRAQGAPDTV ITNAIILDHW GIVRADVGIR DGRIVAIGRA GNPDIADGVH PDLQIGPSTD       120
     IISGEGKILT AGGIDTHVHL ISPSQIVEAL ATGLTTLGGG GTGPSEGTKA TTVTPGAWHL       180
     ETIHRSIDPY PINLLLLGKG NTVSMAGLKE QALAGAGGYK VHEDWGSTPA AIDAALRAAD       240
     EWGLQVALHS DSLNESGYVA STIAAIGGRS ISAFHVEGAG GGHAPDILTL AGLPNVIPGS       300
     TNPTLPHTVN TVAEHLDMLM VCHHLNPAVP EDLAFAESRI RATTIAAEDI LHDMGAVSLT       360
     SSDAQAMGRI GEVVCRTWQV AHVMKNRRGD IGGGLPADNF RARRYIAKYT INPAITHGID       420
     HEVGSVEPGK LADLVLWEPK FFGIRPAVVL KGGGLVWGAL GDPNASIPTP QPVLMRPALT       480
     DAIGAQLSLS FVSPFALEDG LADRLGLRRK LSAVKPTRDV GKAQMINNDA LPDIVIKPDT       540
     FEISIDGEVV VPAPAQRLPL AQLYSLF                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page