(data stored in ACNUC30630 zone)

EMBL: CP001737.PE271

CP001737.PE271       Location/Qualifiers
FT   CDS             complement(310489..312153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0279"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bpy:Bphyt_6230 peptidase S13 D-Ala-D-Ala
FT                   carboxypeptidase C; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D- alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76709"
FT                   /db_xref="GOA:C8XK26"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK26"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACV76709.1"
FT                   /translation="MLTGKTSRVLVAGAAVLCLAACTGNSTTVSSSSSTPSSAAGANAS
FT                   TSPSSAVSSSAGTGSEGLTSVPGLPQEALDVMNQPQYALGQWAISVRDIDTGEQIVSLH
FT                   PDTLFEPASVTKTYSTGAAWQELGPDSTVTTPVKRTGEVTGGTLNGDLVLVGKGDITMG
FT                   GRTKPDGTVDFTNLDHNDANGIPGATLTTEDPLTGLNELAAQVKASGINEVSGDVIVDD
FT                   RLWQPHDLVGNPVTPIIINQNVIDFTTTATTPGQPASIVMSPVVAPWQIDNQVQTVEAG
FT                   GKTQIKPTSTDEKTVTLTGTIAADSAPVVNVYLFKDPATYARTAFIEALGRAGVTVTAD
FT                   PVATNPDSALPPKADVDGLTSVAELTSLPLKEEITYINKISYNNGGEAMFCRLAVAAGS
FT                   DDCEQGLRKGQEIWQAAGLDTNAVVLVDGSGLEGNYVTPNSQVQLQTIMAKRPDSQEWL
FT                   DTLPILGVDGSLATVQSTSPSAGKVFGKTGTLAAGDAFNDRYRLPVKALGGQMDTEGGR
FT                   HFAFAVFSTNSLYPDINGIFQANDDVGKVVASIQQAY"
     MLTGKTSRVL VAGAAVLCLA ACTGNSTTVS SSSSTPSSAA GANASTSPSS AVSSSAGTGS        60
     EGLTSVPGLP QEALDVMNQP QYALGQWAIS VRDIDTGEQI VSLHPDTLFE PASVTKTYST       120
     GAAWQELGPD STVTTPVKRT GEVTGGTLNG DLVLVGKGDI TMGGRTKPDG TVDFTNLDHN       180
     DANGIPGATL TTEDPLTGLN ELAAQVKASG INEVSGDVIV DDRLWQPHDL VGNPVTPIII       240
     NQNVIDFTTT ATTPGQPASI VMSPVVAPWQ IDNQVQTVEA GGKTQIKPTS TDEKTVTLTG       300
     TIAADSAPVV NVYLFKDPAT YARTAFIEAL GRAGVTVTAD PVATNPDSAL PPKADVDGLT       360
     SVAELTSLPL KEEITYINKI SYNNGGEAMF CRLAVAAGSD DCEQGLRKGQ EIWQAAGLDT       420
     NAVVLVDGSG LEGNYVTPNS QVQLQTIMAK RPDSQEWLDT LPILGVDGSL ATVQSTSPSA       480
     GKVFGKTGTL AAGDAFNDRY RLPVKALGGQ MDTEGGRHFA FAVFSTNSLY PDINGIFQAN       540
     DDVGKVVASI QQAY                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page