(data stored in ACNUC30630 zone)

EMBL: CP001737.PE274

CP001737.PE274       Location/Qualifiers
FT   CDS             315529..316908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0282"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mxa:MXAN_3577
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76712"
FT                   /db_xref="GOA:C8XK29"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK29"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACV76712.1"
FT                   /translation="MILLMLMIAAVSGAGPVQARTLPAPAAVAAAAPGAFSLAVIPDTQ
FT                   QEVFGADTRFANRTQWLVDNRAALNLAFVLHTGDVVNWDTADHAQYAIARTAMQKLTSA
FT                   GIPWIPAIGNHDTAAVCAGGSACPGQSAHVNVRGTATFNQYFPVSSFPAVNGTFESGKV
FT                   DNAWSTFTAGNMDWLVLNLELWPRAQVISWARDVVAGHPQHNVIVVTHSYLNAGGGIEQ
FT                   GNGGYGDTSPQYLYDNLVRPFSNVKLVFSGHVGNAASRTDVRPDGSKVVSFLGAFHSNS
FT                   TNPVQIVTIDPAAGSVSTRFYAPKDGATWPQYATTVTGVSWGPPQPSGSWVALRAVAND
FT                   RFVTAEAAGAQPLIANRTVAQGWERFILHSLGGNEVNLWSLASQRYVTAEAAGAQPLIA
FT                   NRAEALGWEQFELIDNGDGTVSFRARANNLLVTAEAAGAQSLVANRTAIGGWEKFVLVR
FT                   L"
     MILLMLMIAA VSGAGPVQAR TLPAPAAVAA AAPGAFSLAV IPDTQQEVFG ADTRFANRTQ        60
     WLVDNRAALN LAFVLHTGDV VNWDTADHAQ YAIARTAMQK LTSAGIPWIP AIGNHDTAAV       120
     CAGGSACPGQ SAHVNVRGTA TFNQYFPVSS FPAVNGTFES GKVDNAWSTF TAGNMDWLVL       180
     NLELWPRAQV ISWARDVVAG HPQHNVIVVT HSYLNAGGGI EQGNGGYGDT SPQYLYDNLV       240
     RPFSNVKLVF SGHVGNAASR TDVRPDGSKV VSFLGAFHSN STNPVQIVTI DPAAGSVSTR       300
     FYAPKDGATW PQYATTVTGV SWGPPQPSGS WVALRAVAND RFVTAEAAGA QPLIANRTVA       360
     QGWERFILHS LGGNEVNLWS LASQRYVTAE AAGAQPLIAN RAEALGWEQF ELIDNGDGTV       420
     SFRARANNLL VTAEAAGAQS LVANRTAIGG WEKFVLVRL                              459
//

If you have problems or comments...

PBIL Back to PBIL home page