(data stored in ACNUC30630 zone)

EMBL: CP001737.PE283

CP001737.PE283       Location/Qualifiers
FT   CDS             complement(324567..325238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_3447 major facilitator
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76721"
FT                   /db_xref="GOA:C8XK38"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76721.1"
FT                   /translation="MTGGAILAVLPLAIGLALAALPVTLIPIALAAKRPPAVARAFLLG
FT                   WLLGIAVVGTVVIVLADVIVLPSGNLSWFGYIKIAIGLVLIGLAGRRWLGRPRAGEDPP
FT                   VPGWLASVDAMGAGRAFGLALLLAGLNPKNLALVLAGAVTIAEATAVPAQQAAALAVFT
FT                   VIGSVGVAAPPVLTLVLGDRAGPLLRSVDEWMTRQSTVIVAAVLLVLGVVLIVNGVTAL
FT                   R"
     MTGGAILAVL PLAIGLALAA LPVTLIPIAL AAKRPPAVAR AFLLGWLLGI AVVGTVVIVL        60
     ADVIVLPSGN LSWFGYIKIA IGLVLIGLAG RRWLGRPRAG EDPPVPGWLA SVDAMGAGRA       120
     FGLALLLAGL NPKNLALVLA GAVTIAEATA VPAQQAAALA VFTVIGSVGV AAPPVLTLVL       180
     GDRAGPLLRS VDEWMTRQST VIVAAVLLVL GVVLIVNGVT ALR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page