(data stored in ACNUC30630 zone)

EMBL: CP001737.PE288

CP001737.PE288       Location/Qualifiers
FT   CDS             329692..330342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0296"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pzu:PHZ_c3146
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76726"
FT                   /db_xref="GOA:C8XK43"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK43"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV76726.1"
FT                   /translation="MQLYCIDCTAILRAVAPPVKTRSTYRQEQAAATRVRIAEAARRLF
FT                   TAHGYGSTSIDAIATEAGVAVRTVYSAFGTKRDILSLVCEQWLEQAQARERAQQVLADP
FT                   DPVRRLRGAAGWLTHLYAAGFDVVTIFEGAMDEGPQTRELLRAKLAGRNQVMDAMIASV
FT                   GERLVVPLADAQAVFRAFAAAGVYQELVVDQGWTPDRFEHWLADTLQAQLLGG"
     MQLYCIDCTA ILRAVAPPVK TRSTYRQEQA AATRVRIAEA ARRLFTAHGY GSTSIDAIAT        60
     EAGVAVRTVY SAFGTKRDIL SLVCEQWLEQ AQARERAQQV LADPDPVRRL RGAAGWLTHL       120
     YAAGFDVVTI FEGAMDEGPQ TRELLRAKLA GRNQVMDAMI ASVGERLVVP LADAQAVFRA       180
     FAAAGVYQEL VVDQGWTPDR FEHWLADTLQ AQLLGG                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page