(data stored in ACNUC30630 zone)

EMBL: CP001737.PE290

CP001737.PE290       Location/Qualifiers
FT   CDS             complement(331149..332438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0298"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: bvi:Bcep1808_5907 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76728"
FT                   /db_xref="GOA:C8XK45"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK45"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACV76728.1"
FT                   /translation="MTADATSARPTVAVIGSGVAGLTAAYLLQRRYDVRLFEADERLGG
FT                   HAHTHEVALTHGQVVGLDSGFLVHNDRTYPNLLRLFDELGVATQDSDMSMSVRCDGCGL
FT                   EYAGAKGLSGLFARQSSLARPRYLAMLAQVKYFHRRARAVLDSGDDTLTLDEFLTRGRF
FT                   TDYFAHHFMLPMVAAVWSCGYDGARAYPARYLFTFLDNHGALSVTGSPQWRTVVGGSKT
FT                   YVERVAKDLSAVHTATPVRSVLRRPDGIEIRDDADTVHRVDHAVLAGHPDQTLAMLAEP
FT                   TRDEARLLGAFEYLPSTAMLHTDASVLPRAPKARASWNYRMAQCHAEPDRVKISYDISR
FT                   LQRITDERTYVVTLNDDPDAPGAVDPGSVLARMNYAHPTYTRASVAAQRELPQLNTDRL
FT                   AFAGAWQGWGFHEDGCLSGVRAAASLGVQW"
     MTADATSARP TVAVIGSGVA GLTAAYLLQR RYDVRLFEAD ERLGGHAHTH EVALTHGQVV        60
     GLDSGFLVHN DRTYPNLLRL FDELGVATQD SDMSMSVRCD GCGLEYAGAK GLSGLFARQS       120
     SLARPRYLAM LAQVKYFHRR ARAVLDSGDD TLTLDEFLTR GRFTDYFAHH FMLPMVAAVW       180
     SCGYDGARAY PARYLFTFLD NHGALSVTGS PQWRTVVGGS KTYVERVAKD LSAVHTATPV       240
     RSVLRRPDGI EIRDDADTVH RVDHAVLAGH PDQTLAMLAE PTRDEARLLG AFEYLPSTAM       300
     LHTDASVLPR APKARASWNY RMAQCHAEPD RVKISYDISR LQRITDERTY VVTLNDDPDA       360
     PGAVDPGSVL ARMNYAHPTY TRASVAAQRE LPQLNTDRLA FAGAWQGWGF HEDGCLSGVR       420
     AAASLGVQW                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page