(data stored in ACNUC30630 zone)

EMBL: CP001737.PE293

CP001737.PE293       Location/Qualifiers
FT   CDS             333876..334658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0301"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sfu:Sfum_1521 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76731"
FT                   /db_xref="GOA:C8XK48"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK48"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACV76731.1"
FT                   /translation="MSAVEIIAIFLAGVGAGTINAVVGSGTLVTFPTLVAFGYPPVVAT
FT                   MSNAIGLVPGSASGTFGYRRELQGQGPRLKWQIPASFLGALVGAWLLLHLPEATFKKIV
FT                   PVLLVIALVLVVVQPRLQATIRRRAEAAGRDHDTVTRGRFVALIIATFLVGIYGGYFAA
FT                   AQGILLVGVMGVLLPETMQRMNAAKNLLTLVVNTVAATTYIIVGFDRIAWGAVALIAVG
FT                   SLIGGFVGAHYGRRLSPVVLRGCIVVFGLIALWRLLAV"
     MSAVEIIAIF LAGVGAGTIN AVVGSGTLVT FPTLVAFGYP PVVATMSNAI GLVPGSASGT        60
     FGYRRELQGQ GPRLKWQIPA SFLGALVGAW LLLHLPEATF KKIVPVLLVI ALVLVVVQPR       120
     LQATIRRRAE AAGRDHDTVT RGRFVALIIA TFLVGIYGGY FAAAQGILLV GVMGVLLPET       180
     MQRMNAAKNL LTLVVNTVAA TTYIIVGFDR IAWGAVALIA VGSLIGGFVG AHYGRRLSPV       240
     VLRGCIVVFG LIALWRLLAV                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page