(data stored in ACNUC30630 zone)

EMBL: CP001737.PE296

CP001737.PE296       Location/Qualifiers
FT   CDS             336426..338429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0304"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: sil:SPO1959
FT                   acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76734"
FT                   /db_xref="GOA:C8XK51"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK51"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACV76734.1"
FT                   /translation="MTGNDVVPEVLWSPSKERIARAAITDFADFVSDRTGRTFDDYAAL
FT                   WDYSTGEPADFWGAIADYFQVRWHEQPTEVLPDVSMPGARWFPGGTLNYAEHALAEPAE
FT                   PVAGEPAIIAVAEDGSEQQLTRADLRRQVGAVQAGLRRLGVGQGDRVVALVPNTVHALV
FT                   GFLATAALGAVWSSCSPDFGAPSVIDRFTQISPTVLIAVDGYRYGGKAFPVAETVTKLR
FT                   EALPSLAGAVHVPALGTDVPAGMIGWDELTAQAAEQTFTPVPFDAPLWVLYSSGTTGLP
FT                   KPIVHSVGGILVEHLKSLRLHWDLGRGDRFLWFTTTGWMMWNFLIGGLLVDATVILYDG
FT                   SPGHPDLMTLWRLAEKHRVTLFGTSAPFVAASQKAGLRPAAELDLSSVTAIGSTGSPLS
FT                   TSGFRWIRDEVGADIQIASFSGGTDVCTGVVGGAPTVPVWMGEISCRALGAKVESYSPT
FT                   GEPLIDEVGELVITAPMPSMPVFFWGDEDGSRLRDSYFDDYPGVWRHGDWIRITSRGSC
FT                   VIEGRSDATLNRGGVRMGTAEFYRVVESLHEVADSLVVDTSTAAGEGDLLLFVVLAPDA
FT                   DPVAVTGSVKKLIRQELSPRHVPGAVVAVPAVPRTLNGKKCEVPVKRILGGMAVDTAVS
FT                   RDALADPAGFDEFIRVAQESANRSAAGRGSTG"
     MTGNDVVPEV LWSPSKERIA RAAITDFADF VSDRTGRTFD DYAALWDYST GEPADFWGAI        60
     ADYFQVRWHE QPTEVLPDVS MPGARWFPGG TLNYAEHALA EPAEPVAGEP AIIAVAEDGS       120
     EQQLTRADLR RQVGAVQAGL RRLGVGQGDR VVALVPNTVH ALVGFLATAA LGAVWSSCSP       180
     DFGAPSVIDR FTQISPTVLI AVDGYRYGGK AFPVAETVTK LREALPSLAG AVHVPALGTD       240
     VPAGMIGWDE LTAQAAEQTF TPVPFDAPLW VLYSSGTTGL PKPIVHSVGG ILVEHLKSLR       300
     LHWDLGRGDR FLWFTTTGWM MWNFLIGGLL VDATVILYDG SPGHPDLMTL WRLAEKHRVT       360
     LFGTSAPFVA ASQKAGLRPA AELDLSSVTA IGSTGSPLST SGFRWIRDEV GADIQIASFS       420
     GGTDVCTGVV GGAPTVPVWM GEISCRALGA KVESYSPTGE PLIDEVGELV ITAPMPSMPV       480
     FFWGDEDGSR LRDSYFDDYP GVWRHGDWIR ITSRGSCVIE GRSDATLNRG GVRMGTAEFY       540
     RVVESLHEVA DSLVVDTSTA AGEGDLLLFV VLAPDADPVA VTGSVKKLIR QELSPRHVPG       600
     AVVAVPAVPR TLNGKKCEVP VKRILGGMAV DTAVSRDALA DPAGFDEFIR VAQESANRSA       660
     AGRGSTG                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page