(data stored in ACNUC30630 zone)

EMBL: CP001737.PE303

CP001737.PE303       Location/Qualifiers
FT   CDS             345515..346408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0311"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   sfu:Sfum_0755 TolB, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76741"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK58"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACV76741.1"
FT                   /translation="MPRSAPLTDTQLIATRNEDDKNDLSVIDTTTGMVVGKLTDGSPGS
FT                   QYPTMSPDRSTIVYAQTSDHGIELRMMAADGSGDRSLLAADSEFCPNPQRPAWNPMDTS
FT                   EIAVACRRGEDPDTLALISVDGTLRSTINTGFPSFDDPTYSPDGKTLAYWASQTPGSTS
FT                   GAIYTQPVNGSEAPKQITSPGARANDVDPVWSVDGKTIYFRRATEDASGQSSAQILRVQ
FT                   ADGSGLTPITDGTAFDNDPSVSPDGTQLAFFSNRTNAAGNNAGQIWVINVDGTGLRQIG
FT                   IGKPGTASGPPEWSRR"
     MPRSAPLTDT QLIATRNEDD KNDLSVIDTT TGMVVGKLTD GSPGSQYPTM SPDRSTIVYA        60
     QTSDHGIELR MMAADGSGDR SLLAADSEFC PNPQRPAWNP MDTSEIAVAC RRGEDPDTLA       120
     LISVDGTLRS TINTGFPSFD DPTYSPDGKT LAYWASQTPG STSGAIYTQP VNGSEAPKQI       180
     TSPGARANDV DPVWSVDGKT IYFRRATEDA SGQSSAQILR VQADGSGLTP ITDGTAFDND       240
     PSVSPDGTQL AFFSNRTNAA GNNAGQIWVI NVDGTGLRQI GIGKPGTASG PPEWSRR          297
//

If you have problems or comments...

PBIL Back to PBIL home page