(data stored in ACNUC30630 zone)

EMBL: CP001737.PE313

CP001737.PE313       Location/Qualifiers
FT   CDS             complement(355686..357260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0321"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: regulatory protein
FT                   LuxR; KEGG: mlo:mll1989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76751"
FT                   /db_xref="GOA:C8XK68"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK68"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76751.1"
FT                   /translation="MLAADPAPARPRRAEVLAALSLALDLGLGQPMEHMLRAAVIATRM
FT                   ADRIGMDATERGVVYYAELVSWIGCQADSPELSALFADEIAFRAGTFPIDLRGRNRARF
FT                   LLGQAGHGRPPLAGGRARLRLLADGRRRMHELLESHYASAGALADRLGLGAGVRDAIHH
FT                   TFERWDGTGLPRGIGGPAIPIAMRIVHVADVIEVQLRAAGPEAAVQLARRRSGTQFDPQ
FT                   VVAVLTGAADEIFAGLDQQDVWPLALSQAPDPRLALSDPEVDALLIAIGDFVDVKSPRR
FT                   QGHSRRVGALAARAGQSRGLPETTVHALRRAGWVHDLGRLGVPGALWDRSGPLSSADRE
FT                   RIRLYPYFTQRILGRVGGLAEVAEIAGAHRERLDGSGFPRGVDGSSLSVPARLLAAAAR
FT                   LQSLTEERLDRPAVGLAQAVRTLEREAAAGALDAQAVAAVADAAGQPQPRRRARATGLT
FT                   AREEQVLALAAVGRSSRQIAAELTISEKTARNHLEHIYTKTGVSNRAGASLFAVQHGIV
FT                   RAGPPTG"
     MLAADPAPAR PRRAEVLAAL SLALDLGLGQ PMEHMLRAAV IATRMADRIG MDATERGVVY        60
     YAELVSWIGC QADSPELSAL FADEIAFRAG TFPIDLRGRN RARFLLGQAG HGRPPLAGGR       120
     ARLRLLADGR RRMHELLESH YASAGALADR LGLGAGVRDA IHHTFERWDG TGLPRGIGGP       180
     AIPIAMRIVH VADVIEVQLR AAGPEAAVQL ARRRSGTQFD PQVVAVLTGA ADEIFAGLDQ       240
     QDVWPLALSQ APDPRLALSD PEVDALLIAI GDFVDVKSPR RQGHSRRVGA LAARAGQSRG       300
     LPETTVHALR RAGWVHDLGR LGVPGALWDR SGPLSSADRE RIRLYPYFTQ RILGRVGGLA       360
     EVAEIAGAHR ERLDGSGFPR GVDGSSLSVP ARLLAAAARL QSLTEERLDR PAVGLAQAVR       420
     TLEREAAAGA LDAQAVAAVA DAAGQPQPRR RARATGLTAR EEQVLALAAV GRSSRQIAAE       480
     LTISEKTARN HLEHIYTKTG VSNRAGASLF AVQHGIVRAG PPTG                        524
//

If you have problems or comments...

PBIL Back to PBIL home page