(data stored in ACNUC30630 zone)

EMBL: CP001737.PE314

CP001737.PE314       Location/Qualifiers
FT   CDS             357380..357763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oca:OCAR_7467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76752"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK69"
FT                   /inference="similar to AA sequence:KEGG:OCAR_7467"
FT                   /protein_id="ACV76752.1"
FT                   /translation="MVAMSQAVGKAVISLCTGLEDAEKVTVAFLVAVGAAEQGRTTLMF
FT                   LTKEAVRLATGSVATGVACAGCPPLADLVARYAAAGGSYLVCPLCFDAKALSAQTLVAN
FT                   ATLGGTVPLWQWIGDDPVVTFSY"
     MVAMSQAVGK AVISLCTGLE DAEKVTVAFL VAVGAAEQGR TTLMFLTKEA VRLATGSVAT        60
     GVACAGCPPL ADLVARYAAA GGSYLVCPLC FDAKALSAQT LVANATLGGT VPLWQWIGDD       120
     PVVTFSY                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page