(data stored in ACNUC30630 zone)

EMBL: CP001737.PE318

CP001737.PE318       Location/Qualifiers
FT   CDS             361499..362044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0326"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: mxa:MXAN_5877
FT                   YceI-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76756"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y5"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACV76756.1"
FT                   /translation="MTAPARAVTPSAAMVGWWAVDPATSTARFRVRDKLVATARGTIAV
FT                   AGGTIRIGAAGDVVSARVELTTASIDTGNRHRDRDLRTERFLSADRHPTIVVQAAPAPA
FT                   RSDGWTVPAQLQARGSSVPVDLTVTLTAVDEGSAAVRITGRLDRSGLGIKVPGFVIARF
FT                   VDLEVDIRAHRLDHTPAD"
     MTAPARAVTP SAAMVGWWAV DPATSTARFR VRDKLVATAR GTIAVAGGTI RIGAAGDVVS        60
     ARVELTTASI DTGNRHRDRD LRTERFLSAD RHPTIVVQAA PAPARSDGWT VPAQLQARGS       120
     SVPVDLTVTL TAVDEGSAAV RITGRLDRSG LGIKVPGFVI ARFVDLEVDI RAHRLDHTPA       180
     D                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page