(data stored in ACNUC30630 zone)

EMBL: CP001737.PE325

CP001737.PE325       Location/Qualifiers
FT   CDS             complement(369189..369689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76763"
FT                   /db_xref="GOA:C8X5Z2"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76763.1"
FT                   /translation="MGDNGSSSKATRIGLEILGWLLVAAGVAALILPGPGLLLLALGLW
FT                   VLAKNYEWADRLLDPVKRAAYRGAAEGVKSWPRIIMSTTLALGLIAVGVIWGIRPAAPG
FT                   WWPLAEKWWLFGGWGTGVFLIFSGLLALGLLGWSMKNFRYGTMTLDELYRDQKLNERPG
FT                   RRR"
     MGDNGSSSKA TRIGLEILGW LLVAAGVAAL ILPGPGLLLL ALGLWVLAKN YEWADRLLDP        60
     VKRAAYRGAA EGVKSWPRII MSTTLALGLI AVGVIWGIRP AAPGWWPLAE KWWLFGGWGT       120
     GVFLIFSGLL ALGLLGWSMK NFRYGTMTLD ELYRDQKLNE RPGRRR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page