(data stored in ACNUC30630 zone)

EMBL: CP001737.PE33

CP001737.PE33        Location/Qualifiers
FT   CDS             38984..40609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0033"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1271 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76471"
FT                   /db_xref="GOA:C8XHY0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACV76471.1"
FT                   /translation="MSPKHAAPEPGAVDGSAPPPQLTKNQLTKNPAPTPVAADDDKLDG
FT                   TVWRIAGVVVLGAIMSILDVTVVSVALPTFQTTFDASYATVAWTMTGYTLALATVIPLT
FT                   GWAADRFGTKRLYMLALTLFLLGSIACGLAWSIESLIAFRVLQGLGGGMLMPLGMTIMT
FT                   HAAGPHRIGRVMAVLGVPMLLGPIFGPILGGWLIETASWHWIFFINVPIGIVALIAAWR
FT                   VLAKDEPSPSESFDFVGMLLLSPGLALFLFGVSTIPEEGTFASAKVIIPLVVGLLLMTG
FT                   FVFHALRRQDHPLIDLHLFKRKQMSVSVITMSLFAIAFFGAMLLLPTYFIQVREESTLT
FT                   AGLLLAPQGIGAMLTMPIAGRLTDKMGPGKFVITGLFLILIGMSVFTQISSTTPIPLLL
FT                   GALFINGLGMGMTMMPIMTAALATLRHAEVARGSTLMNIVQQSAASVGTAVMSVILTNQ
FT                   FLSKPAIQAAKAAQENPAAMANVPPDVLAQAKAQVQEQMAEAFGTTFWVALAILVVTLI
FT                   PAFMLPRKARETVGEEPAAPVVLH"
     MSPKHAAPEP GAVDGSAPPP QLTKNQLTKN PAPTPVAADD DKLDGTVWRI AGVVVLGAIM        60
     SILDVTVVSV ALPTFQTTFD ASYATVAWTM TGYTLALATV IPLTGWAADR FGTKRLYMLA       120
     LTLFLLGSIA CGLAWSIESL IAFRVLQGLG GGMLMPLGMT IMTHAAGPHR IGRVMAVLGV       180
     PMLLGPIFGP ILGGWLIETA SWHWIFFINV PIGIVALIAA WRVLAKDEPS PSESFDFVGM       240
     LLLSPGLALF LFGVSTIPEE GTFASAKVII PLVVGLLLMT GFVFHALRRQ DHPLIDLHLF       300
     KRKQMSVSVI TMSLFAIAFF GAMLLLPTYF IQVREESTLT AGLLLAPQGI GAMLTMPIAG       360
     RLTDKMGPGK FVITGLFLIL IGMSVFTQIS STTPIPLLLG ALFINGLGMG MTMMPIMTAA       420
     LATLRHAEVA RGSTLMNIVQ QSAASVGTAV MSVILTNQFL SKPAIQAAKA AQENPAAMAN       480
     VPPDVLAQAK AQVQEQMAEA FGTTFWVALA ILVVTLIPAF MLPRKARETV GEEPAAPVVL       540
     H                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page