(data stored in ACNUC30630 zone)

EMBL: CP001737.PE335

CP001737.PE335       Location/Qualifiers
FT   CDS             complement(377177..378121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0343"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   scl:sce0047 putative 3-oxoacyl-[acyl-carrier- protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76773"
FT                   /db_xref="GOA:C8X602"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X602"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV76773.1"
FT                   /translation="MHVQGNESTRRPVALIIGASSGIGRSTAQALSREGWNLVLASRSA
FT                   PALAEVERECARYGVDTTVIPTDVRDRAAIESLLVQAAAGSGRVDAVVNTAACVAYGRF
FT                   DQIPAEIYDQVIATNLLGTANVARAALRQFRSQGGGELVLMGSLLGKIAVPFMSPYVTS
FT                   KWGVHALTRMIQLEAREIPGVHVTLVSPGSVNTPAYSQAANYASREGRPPPPVDPPEKV
FT                   ARAVVKSLTQPRRERSVGLANHIVVLGFRLLPAVFDLAVGPLMKLTGLSRRPVADHPGS
FT                   VLHPHPAGEAEHGFWDRLGRRHESADSPVPVAP"
     MHVQGNESTR RPVALIIGAS SGIGRSTAQA LSREGWNLVL ASRSAPALAE VERECARYGV        60
     DTTVIPTDVR DRAAIESLLV QAAAGSGRVD AVVNTAACVA YGRFDQIPAE IYDQVIATNL       120
     LGTANVARAA LRQFRSQGGG ELVLMGSLLG KIAVPFMSPY VTSKWGVHAL TRMIQLEARE       180
     IPGVHVTLVS PGSVNTPAYS QAANYASREG RPPPPVDPPE KVARAVVKSL TQPRRERSVG       240
     LANHIVVLGF RLLPAVFDLA VGPLMKLTGL SRRPVADHPG SVLHPHPAGE AEHGFWDRLG       300
     RRHESADSPV PVAP                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page