(data stored in ACNUC30630 zone)

EMBL: CP001737.PE336

CP001737.PE336       Location/Qualifiers
FT   CDS             378376..379566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0344"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   pzu:PHZ_c1058 glutathione-dependent formaldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76774"
FT                   /db_xref="GOA:C8X603"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X603"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACV76774.1"
FT                   /translation="MKAVTWQGKRSLRVDEVPDPTIQEPTDAIVRITSTAICGSDLHLY
FT                   EVLGPYLSAGDILGHEPMGIVEEVGAGVTHIKPGDRVVIPFNISCGHCGMCRDGLQSQC
FT                   ETTQVRAQGKGAALFGYTSLYGSVPGGQAEYLRVPQAQYGPIPVSPDGPDERYLFLSDI
FT                   LPTAWQAVQYAAVPDGGTLVVFGLGPVGQFASRIGHHLGHRVIGIDPVPERRAMAERHG
FT                   IQTLDPAGLDDVPATVLELTGGYGAHGVIDAVGMEAHGGAGAAAGKFAQSAVGLLPDTL
FT                   ARKLIENVGVDRLTALHDSIGSVRRGGTVSVSGVYGGTADPMPMMDLFDKQVQLRMGQC
FT                   NVRKWIGDILPLVEDSADPLGVLDLTTHTLPLTDAPQAYQTFQEKSDGCVKVVLKP"
     MKAVTWQGKR SLRVDEVPDP TIQEPTDAIV RITSTAICGS DLHLYEVLGP YLSAGDILGH        60
     EPMGIVEEVG AGVTHIKPGD RVVIPFNISC GHCGMCRDGL QSQCETTQVR AQGKGAALFG       120
     YTSLYGSVPG GQAEYLRVPQ AQYGPIPVSP DGPDERYLFL SDILPTAWQA VQYAAVPDGG       180
     TLVVFGLGPV GQFASRIGHH LGHRVIGIDP VPERRAMAER HGIQTLDPAG LDDVPATVLE       240
     LTGGYGAHGV IDAVGMEAHG GAGAAAGKFA QSAVGLLPDT LARKLIENVG VDRLTALHDS       300
     IGSVRRGGTV SVSGVYGGTA DPMPMMDLFD KQVQLRMGQC NVRKWIGDIL PLVEDSADPL       360
     GVLDLTTHTL PLTDAPQAYQ TFQEKSDGCV KVVLKP                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page