(data stored in ACNUC30630 zone)

EMBL: CP001737.PE358

CP001737.PE358       Location/Qualifiers
FT   CDS             401137..401784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0368"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG:
FT                   ank:AnaeK_4117 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76796"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C8X625"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACV76796.1"
FT                   /translation="MSERIDRQWQPPEDALATTVEARKGAGSPWAKALREMGAVDRAVY
FT                   QAVADTPTPHLDAHVRRLSNAANFSRLWLGLAAGIAVFGGKRGHRAALEGVVAIGATSA
FT                   AVNLGIKPIARRRRPERAADTGQARFVSMPGSTSFPSGHSASAFAFAYAVGRHLPGLAV
FT                   PIRLLAGGVAYSRVHTGVHYPGDVAIGSIVGAGTAAIVAAASDGLSRSRRRD"
     MSERIDRQWQ PPEDALATTV EARKGAGSPW AKALREMGAV DRAVYQAVAD TPTPHLDAHV        60
     RRLSNAANFS RLWLGLAAGI AVFGGKRGHR AALEGVVAIG ATSAAVNLGI KPIARRRRPE       120
     RAADTGQARF VSMPGSTSFP SGHSASAFAF AYAVGRHLPG LAVPIRLLAG GVAYSRVHTG       180
     VHYPGDVAIG SIVGAGTAAI VAAASDGLSR SRRRD                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page