(data stored in ACNUC30630 zone)

EMBL: CP001737.PE371

CP001737.PE371       Location/Qualifiers
FT   CDS             complement(415476..417311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0382"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   xop:PXO_02887 glycosyl hydrolase, family 15"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76809"
FT                   /db_xref="GOA:C8X638"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C8X638"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ACV76809.1"
FT                   /translation="MTASRRHRIGLDHTSFPPHVLREYALLADGERGAVLGPGGDIVWM
FT                   CMPRWDSDAVFAALLDGPGAYSVTPLGRFVWGGSYEAGSMIWRSRWVTDDGIIECREAL
FT                   AFPGEPHRAVLLRRVVANDRDAQVRVTLAPRARFGRHGFTELHHADHSWTGRSGPLHLR
FT                   WTGAPAGIRRVNPHHELTTDLLVPAGGHHDLVLEIGDQALPSDPPDPETAWQATAAAWS
FT                   AAVPDLQNCLEPADARRSYAVLRGLTAASGGMVAAATTSLPERAEGSRNYDYRYVWIRD
FT                   QCYAGQAAAAAAAPALLDDAVRFVTARILDHGPDLRPAYTTQGAPVPDQRTVDLPGYPG
FT                   GGNMIGNWVNQQFQLDAFGESLLLLAAAGRADRLDVDHWKAARIATDAVAARWTEPDAG
FT                   IWEIDPQPWTHSRLTCVAGLRAIARLPHAGTAAGAWLTLADQITAHTAARATHPTGRWQ
FT                   RSPQGPGVDAALLLPSLRGGIDPADPRSDATLIAYLADLTRDGYAYRFRHDDRPLADAE
FT                   GSFTLCGFLVALSLHQQHRPIAAARWYERTRGCVGPPELYSEEFDVAHHQLRGNLPQAF
FT                   VHALHLEAAARLSEPSASPSRPSIDFQSSSPELRL"
     MTASRRHRIG LDHTSFPPHV LREYALLADG ERGAVLGPGG DIVWMCMPRW DSDAVFAALL        60
     DGPGAYSVTP LGRFVWGGSY EAGSMIWRSR WVTDDGIIEC REALAFPGEP HRAVLLRRVV       120
     ANDRDAQVRV TLAPRARFGR HGFTELHHAD HSWTGRSGPL HLRWTGAPAG IRRVNPHHEL       180
     TTDLLVPAGG HHDLVLEIGD QALPSDPPDP ETAWQATAAA WSAAVPDLQN CLEPADARRS       240
     YAVLRGLTAA SGGMVAAATT SLPERAEGSR NYDYRYVWIR DQCYAGQAAA AAAAPALLDD       300
     AVRFVTARIL DHGPDLRPAY TTQGAPVPDQ RTVDLPGYPG GGNMIGNWVN QQFQLDAFGE       360
     SLLLLAAAGR ADRLDVDHWK AARIATDAVA ARWTEPDAGI WEIDPQPWTH SRLTCVAGLR       420
     AIARLPHAGT AAGAWLTLAD QITAHTAARA THPTGRWQRS PQGPGVDAAL LLPSLRGGID       480
     PADPRSDATL IAYLADLTRD GYAYRFRHDD RPLADAEGSF TLCGFLVALS LHQQHRPIAA       540
     ARWYERTRGC VGPPELYSEE FDVAHHQLRG NLPQAFVHAL HLEAAARLSE PSASPSRPSI       600
     DFQSSSPELR L                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page