(data stored in ACNUC30630 zone)

EMBL: CP001737.PE379

CP001737.PE379       Location/Qualifiers
FT   CDS             424963..425985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0391"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sme:SM_b21423 putative sugar uptake ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76817"
FT                   /db_xref="GOA:C8X646"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8X646"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV76817.1"
FT                   /translation="MTAHSRPPDRRAVLTRVVLAVSGVVAFIAFTVTIPYFLTVDNLAN
FT                   LLNDVALVGIVALPATFLMMSGQVDLSVGAAAAFVGIVLARTAPDSGLLPAVLLAIGTG
FT                   ALIGLVNGLLVTEGEVNSIAATFASMALLRGLAYLVPSGLAIALPGFRSLGTLRPVLGI
FT                   ALPTLIFAAIALVAALMSRSAIGRRSRAIGSLPAAQRMDGSGERHWIIALFVASGLAAA
FT                   LAGLIRTSQLGTGLPTAGIGIELTVVTAVLLGGGHLTGGRGSVGGTLLALLLMAIVDNG
FT                   MSLANVTPYAAQVFHAGLLLLALMIDRPRRRSRTRSPARTKQGGDSVRIDGASDPRVPG
FT                   "
     MTAHSRPPDR RAVLTRVVLA VSGVVAFIAF TVTIPYFLTV DNLANLLNDV ALVGIVALPA        60
     TFLMMSGQVD LSVGAAAAFV GIVLARTAPD SGLLPAVLLA IGTGALIGLV NGLLVTEGEV       120
     NSIAATFASM ALLRGLAYLV PSGLAIALPG FRSLGTLRPV LGIALPTLIF AAIALVAALM       180
     SRSAIGRRSR AIGSLPAAQR MDGSGERHWI IALFVASGLA AALAGLIRTS QLGTGLPTAG       240
     IGIELTVVTA VLLGGGHLTG GRGSVGGTLL ALLLMAIVDN GMSLANVTPY AAQVFHAGLL       300
     LLALMIDRPR RRSRTRSPAR TKQGGDSVRI DGASDPRVPG                             340
//

If you have problems or comments...

PBIL Back to PBIL home page