(data stored in ACNUC30630 zone)

EMBL: CP001737.PE390

CP001737.PE390       Location/Qualifiers
FT   CDS             complement(437222..438535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0405"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; KEGG: ret:RHE_CH00589 Na+/H+ antiporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76828"
FT                   /db_xref="GOA:C8X657"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C8X657"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACV76828.1"
FT                   /translation="MVGSPRTLFSPGTWAEDGRVAHILRKETVGGGLLLLATVVALVWA
FT                   NTAVSESYFQLLDTELGPAALHLNLTVGEWAGDGLLAIFFFVAGLELKREFVAGDLRDP
FT                   HRAVVPVAAAFGGMIVPALLYLVIAGGTGPKGWAIPTATDIAFALAVLAVISTHLPAAL
FT                   RTFLLTLAVVDDLLAITIIAVFYTDDLQPVWLLLALAPLALFTVLVQRRISSWWLLLPL
FT                   AFVTWSLVHASGVHATVAGVLLGFAVPVRARKVRGKDDDRPGMAEHFEHLWRPISAGIA
FT                   VPVFALFSAGVAIGGWSGLRSALTDPIAVGIIAGLVLGKPVGILTATYLTSRLTRRPLQ
FT                   RGLTWPDLTGVALLGGVGFTVSLLIGELAFGGSSAADDHVKIAVLAGSVTAAVLAAVLL
FT                   RMRNRRYRAICEEEERDDDHDGIPDIYQMRTPLDPPES"
     MVGSPRTLFS PGTWAEDGRV AHILRKETVG GGLLLLATVV ALVWANTAVS ESYFQLLDTE        60
     LGPAALHLNL TVGEWAGDGL LAIFFFVAGL ELKREFVAGD LRDPHRAVVP VAAAFGGMIV       120
     PALLYLVIAG GTGPKGWAIP TATDIAFALA VLAVISTHLP AALRTFLLTL AVVDDLLAIT       180
     IIAVFYTDDL QPVWLLLALA PLALFTVLVQ RRISSWWLLL PLAFVTWSLV HASGVHATVA       240
     GVLLGFAVPV RARKVRGKDD DRPGMAEHFE HLWRPISAGI AVPVFALFSA GVAIGGWSGL       300
     RSALTDPIAV GIIAGLVLGK PVGILTATYL TSRLTRRPLQ RGLTWPDLTG VALLGGVGFT       360
     VSLLIGELAF GGSSAADDHV KIAVLAGSVT AAVLAAVLLR MRNRRYRAIC EEEERDDDHD       420
     GIPDIYQMRT PLDPPES                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page