(data stored in ACNUC30630 zone)

EMBL: CP001737.PE392

CP001737.PE392       Location/Qualifiers
FT   CDS             439641..440807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0408"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: net:Neut_0318
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76830"
FT                   /db_xref="GOA:C8X659"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X659"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACV76830.1"
FT                   /translation="MHVSAAFLVEFGILLLILGAVSAVAGKLGLSAVPLFLIAGLFVGP
FT                   GGLLPVPAAAPFLEAGAVIGVVLLLLSLGLEFSADEFTQALRRHTPSGVVDLVLNAVPG
FT                   VVAGLLLGLPVAGVVALGGITWVSSSGIVSRTLSDLGRLGYRETPAVLSVLVLEDVAMA
FT                   VYLPMLGILLAGTAFLAGLAGVLVAVVALIGVLMLSRWSGPVIGWLITHDSDEQVLLRL
FT                   LALTLLVAGAAEYMGISAAVGAFLVGLAVPAEAAESVRRVIGPLRDLFAAAFFLSFGYA
FT                   IDPRDMPPALVVAALLAVVTAVTKVITGWFAARRDGVGARGRRRAGTALIARGEFSMVI
FT                   AGLAVAAGVTEIGPLAATYVLLLAVGGSLLTRLSGQGRDRLAHPHRQA"
     MHVSAAFLVE FGILLLILGA VSAVAGKLGL SAVPLFLIAG LFVGPGGLLP VPAAAPFLEA        60
     GAVIGVVLLL LSLGLEFSAD EFTQALRRHT PSGVVDLVLN AVPGVVAGLL LGLPVAGVVA       120
     LGGITWVSSS GIVSRTLSDL GRLGYRETPA VLSVLVLEDV AMAVYLPMLG ILLAGTAFLA       180
     GLAGVLVAVV ALIGVLMLSR WSGPVIGWLI THDSDEQVLL RLLALTLLVA GAAEYMGISA       240
     AVGAFLVGLA VPAEAAESVR RVIGPLRDLF AAAFFLSFGY AIDPRDMPPA LVVAALLAVV       300
     TAVTKVITGW FAARRDGVGA RGRRRAGTAL IARGEFSMVI AGLAVAAGVT EIGPLAATYV       360
     LLLAVGGSLL TRLSGQGRDR LAHPHRQA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page