(data stored in ACNUC30630 zone)

EMBL: CP001737.PE393

CP001737.PE393       Location/Qualifiers
FT   CDS             441592..442167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0409"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: dat:HRM2_24220 TRAP-type
FT                   C4-dicarboxylate transporter, periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76831"
FT                   /db_xref="GOA:C8X660"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X660"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76831.1"
FT                   /translation="MRASTRCPHAGDGSEAVQRAAMMDIDLAILDIAMPRMTGLQAARE
FT                   ISRRATGLRILMLSMYDNEQYFFEALKAGAAGYVLKSVADRDLVEACRAVRRGEPFVYA
FT                   GALTALITEYLRRSRNGDRIPTSILTPREEEIVKLIAEGHSSREIADTLVISAKTVDRH
FT                   RANIMQKLGMHDRLDLTRFAIRVGLVEP"
     MRASTRCPHA GDGSEAVQRA AMMDIDLAIL DIAMPRMTGL QAAREISRRA TGLRILMLSM        60
     YDNEQYFFEA LKAGAAGYVL KSVADRDLVE ACRAVRRGEP FVYAGALTAL ITEYLRRSRN       120
     GDRIPTSILT PREEEIVKLI AEGHSSREIA DTLVISAKTV DRHRANIMQK LGMHDRLDLT       180
     RFAIRVGLVE P                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page