(data stored in ACNUC30630 zone)

EMBL: CP001737.PE399

CP001737.PE399       Location/Qualifiers
FT   CDS             complement(447759..450494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0415"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: pol:Bpro_3193 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76837"
FT                   /db_xref="GOA:C8X666"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C8X666"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76837.1"
FT                   /translation="MRYFRRVLVGREPERQLLGALVEGARRGLAGTLVVRGEPGVGKSA
FT                   LLEELVAGADATVLRTQGVAVEAPLVFAALHRLLRPLARLHARLPEPQARALRIVFGEE
FT                   AGGSVEPFLVGVATLSLLTSAAEENLVLCVVDDAHWLDPATAGALLFCARRLGADRVAM
FT                   VFAARDGAWGSFDAHGLPETVLAGLDPVDSRTLLQERLGSATAADVLDRLVAETRGNPL
FT                   ALMELPGELTPGQLSGSAPLPSQLHLTAQVEQVFLDRSRRLPAAVQTMLLLAAADDTGE
FT                   LEMVRQAATALGLDEADLQAALGSGLLVGGSTSIAVRHPLVRSAIYQAATGAQRREVHR
FT                   VLAVALSGRGDPDRKAWHLASAAQGPDREVVGALQAVGARAQRRGGHAAALAAYERAAA
FT                   LCDDRARRAELTFAAARSAWACGRAGPAQTLLTAAREGADDPLLLGDIARLRGHIEVNL
FT                   GSAAEAHRIFVEAAQQVYPLDAARALDIGVAAAVMRTFGADSGTPLAATHALVAPVGGD
FT                   PPRTRCLRLLLAAMTSVSEGDWSAATVALDLALEVGEQVDDRDLLWNLGNAALQLGDDQ
FT                   AQQRFYGYALSRAREAGAVTAIVYCLQRLCFGYYLAGDLVAVRSSAEEALSLGSSIGQP
FT                   AMTAPPVAWLTLLAALQDRDDYDEQLARLGELVAAHPLGILSDPVHDLTRWAKGLRAAG
FT                   SGDGFGAVHHLARFRMPVLARMAAPERIEAAARAGDAAAATGWTEELARFADATRRPWA
FT                   LATVAFGRALLAGQADAEALFHESLTHHKRAERPLAAARAQLAYGEWLRRSQRRVDARK
FT                   HLREAVETFQDLRAEPLIARASQELRASGETARKRDPTTLVTLTPTELQIARLVSSGLS
FT                   NKDVAAQCWVSPRTVAFHLRNVFAKAGVTSRGELARLDLG"
     MRYFRRVLVG REPERQLLGA LVEGARRGLA GTLVVRGEPG VGKSALLEEL VAGADATVLR        60
     TQGVAVEAPL VFAALHRLLR PLARLHARLP EPQARALRIV FGEEAGGSVE PFLVGVATLS       120
     LLTSAAEENL VLCVVDDAHW LDPATAGALL FCARRLGADR VAMVFAARDG AWGSFDAHGL       180
     PETVLAGLDP VDSRTLLQER LGSATAADVL DRLVAETRGN PLALMELPGE LTPGQLSGSA       240
     PLPSQLHLTA QVEQVFLDRS RRLPAAVQTM LLLAAADDTG ELEMVRQAAT ALGLDEADLQ       300
     AALGSGLLVG GSTSIAVRHP LVRSAIYQAA TGAQRREVHR VLAVALSGRG DPDRKAWHLA       360
     SAAQGPDREV VGALQAVGAR AQRRGGHAAA LAAYERAAAL CDDRARRAEL TFAAARSAWA       420
     CGRAGPAQTL LTAAREGADD PLLLGDIARL RGHIEVNLGS AAEAHRIFVE AAQQVYPLDA       480
     ARALDIGVAA AVMRTFGADS GTPLAATHAL VAPVGGDPPR TRCLRLLLAA MTSVSEGDWS       540
     AATVALDLAL EVGEQVDDRD LLWNLGNAAL QLGDDQAQQR FYGYALSRAR EAGAVTAIVY       600
     CLQRLCFGYY LAGDLVAVRS SAEEALSLGS SIGQPAMTAP PVAWLTLLAA LQDRDDYDEQ       660
     LARLGELVAA HPLGILSDPV HDLTRWAKGL RAAGSGDGFG AVHHLARFRM PVLARMAAPE       720
     RIEAAARAGD AAAATGWTEE LARFADATRR PWALATVAFG RALLAGQADA EALFHESLTH       780
     HKRAERPLAA ARAQLAYGEW LRRSQRRVDA RKHLREAVET FQDLRAEPLI ARASQELRAS       840
     GETARKRDPT TLVTLTPTEL QIARLVSSGL SNKDVAAQCW VSPRTVAFHL RNVFAKAGVT       900
     SRGELARLDL G                                                            911
//

If you have problems or comments...

PBIL Back to PBIL home page