(data stored in ACNUC30630 zone)

EMBL: CP001737.PE40

CP001737.PE40        Location/Qualifiers
FT   CDS             complement(46106..47761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0040"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: mxa:MXAN_4343 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76478"
FT                   /db_xref="GOA:C8XHY7"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY7"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACV76478.1"
FT                   /translation="MEGARPVRAPRGTSLTAKSWTTEAPLRMLMNNLDPENAERPDDLV
FT                   VYGGTGKAARDWNSFDAMVRTLTTLEADETMLVQSGRPVGVMRTHEWAPRVILANSNLV
FT                   PDWANWPEFRRLEKLGLTMYGQMTAGSWIYIGSQGIVQGTYETFAAIAEKRFNGTLAGT
FT                   LTLTGGAGGMGGAQPLAVTLNGGACLIVDVDESRLQRRVEHRYLDEIAVDIDDAIAKSL
FT                   QAKAQRKAWSVGLVGNCAEVFPELLRRGVDIDIVTDQTSAHDPLSYLPAGVSIEDWPDY
FT                   AERKPEEFTDRARESMARHVEAMVGFQDAGAEVFDYGNSIRDEARQGGYERAFDFPGFV
FT                   PAYIRPLFCQGKGPFRWAALSGDPKDIYATDQAVMDLFPDNDRLQKWMRGAREKISFQG
FT                   LPARICWLGYGERDRAGLRFNEMVASGELSAPIVIGRDHLDCGSVASPYRETESMADGS
FT                   DAIADWPLLNALINTASGASWVSIHHGGGVGIGRSIHAGQVSLADGTALAAEKLARVLT
FT                   NDPGMGVIRHVDAGYELAEQVAADQGVRIPMKEG"
     MEGARPVRAP RGTSLTAKSW TTEAPLRMLM NNLDPENAER PDDLVVYGGT GKAARDWNSF        60
     DAMVRTLTTL EADETMLVQS GRPVGVMRTH EWAPRVILAN SNLVPDWANW PEFRRLEKLG       120
     LTMYGQMTAG SWIYIGSQGI VQGTYETFAA IAEKRFNGTL AGTLTLTGGA GGMGGAQPLA       180
     VTLNGGACLI VDVDESRLQR RVEHRYLDEI AVDIDDAIAK SLQAKAQRKA WSVGLVGNCA       240
     EVFPELLRRG VDIDIVTDQT SAHDPLSYLP AGVSIEDWPD YAERKPEEFT DRARESMARH       300
     VEAMVGFQDA GAEVFDYGNS IRDEARQGGY ERAFDFPGFV PAYIRPLFCQ GKGPFRWAAL       360
     SGDPKDIYAT DQAVMDLFPD NDRLQKWMRG AREKISFQGL PARICWLGYG ERDRAGLRFN       420
     EMVASGELSA PIVIGRDHLD CGSVASPYRE TESMADGSDA IADWPLLNAL INTASGASWV       480
     SIHHGGGVGI GRSIHAGQVS LADGTALAAE KLARVLTNDP GMGVIRHVDA GYELAEQVAA       540
     DQGVRIPMKE G                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page