(data stored in ACNUC30630 zone)

EMBL: CP001737.PE400

CP001737.PE400       Location/Qualifiers
FT   CDS             450572..451228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0416"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: pla:Plav_0470
FT                   ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76838"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8X667"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACV76838.1"
FT                   /translation="MNDTRDHVADDSVPRDPTPGDRRRRQIGILLFDGVEELDAVGPWE
FT                   VLSTWTQQHPDDGWDAFCLSSDGRPVRSAKTLVIGAHHSIDDAPVMDILVHPGGPGTRP
FT                   MLRNRGHLDWVRRQRATVPLMTSVCTGSLVYAAAGLLVRRRATTHWAWLNLLSEMDPTV
FT                   ITDVSSRFVDDGDLITSAGVSAGIDMALHLVARLTDVERAREIRRDIQYNPLPPV"
     MNDTRDHVAD DSVPRDPTPG DRRRRQIGIL LFDGVEELDA VGPWEVLSTW TQQHPDDGWD        60
     AFCLSSDGRP VRSAKTLVIG AHHSIDDAPV MDILVHPGGP GTRPMLRNRG HLDWVRRQRA       120
     TVPLMTSVCT GSLVYAAAGL LVRRRATTHW AWLNLLSEMD PTVITDVSSR FVDDGDLITS       180
     AGVSAGIDMA LHLVARLTDV ERAREIRRDI QYNPLPPV                               218
//

If you have problems or comments...

PBIL Back to PBIL home page