(data stored in ACNUC30630 zone)

EMBL: CP001737.PE401

CP001737.PE401       Location/Qualifiers
FT   CDS             451284..452255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0417"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   scl:sce1535 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76839"
FT                   /db_xref="GOA:C8X668"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X668"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACV76839.1"
FT                   /translation="MRAVLQDRYGTAEVLRLGSVPRPVIGDHDVLVEVRAAGLDRGTEH
FT                   LMMGKPYAVRLATGLRRPRNPVPGRDVAGTVVEIGAAVTRFAVGDEVYGVAPGSFAEYV
FT                   AAPESRLARKPASLTFTQAAVVPVSAATALRALVDVGRVQAGQSVLVVGASGGVGSYAV
FT                   QIAKALGAEVTGVCSAPKADLVASLGADHVIDYTRDDFADGSRHYDIVLDIAGNPSLNR
FT                   LRRALRPRGTAVFVGGEDAGALTGMGRQLRGALLSIFLKQRLALLVTKERGSDYDRLTE
FT                   MIEAGQLAASIDRIYPLEDAPHAVRQLQAGHVRGKVAITMER"
     MRAVLQDRYG TAEVLRLGSV PRPVIGDHDV LVEVRAAGLD RGTEHLMMGK PYAVRLATGL        60
     RRPRNPVPGR DVAGTVVEIG AAVTRFAVGD EVYGVAPGSF AEYVAAPESR LARKPASLTF       120
     TQAAVVPVSA ATALRALVDV GRVQAGQSVL VVGASGGVGS YAVQIAKALG AEVTGVCSAP       180
     KADLVASLGA DHVIDYTRDD FADGSRHYDI VLDIAGNPSL NRLRRALRPR GTAVFVGGED       240
     AGALTGMGRQ LRGALLSIFL KQRLALLVTK ERGSDYDRLT EMIEAGQLAA SIDRIYPLED       300
     APHAVRQLQA GHVRGKVAIT MER                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page