(data stored in ACNUC30630 zone)

EMBL: CP001737.PE406

CP001737.PE406       Location/Qualifiers
FT   CDS             complement(456617..459628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0423"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: reh:H16_B0754 transcriptional
FT                   regulator, LuxR- family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76844"
FT                   /db_xref="GOA:C8X673"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C8X673"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76844.1"
FT                   /translation="MRSPILHTKLYAARVRGRTVPRPRLTEHLTDFLSGGRLLLISAPA
FT                   GFGKTTTLAQWVQTLSADAATGDRTGTGPAPGQDTGSRGPGDPAVAQTTNPPAVVAWLS
FT                   LDPADNEPGRFCAYVLTAFQHASPGLGADQLHRLEQQAPATTAADATPMIAELLNDIAD
FT                   LPHDVVLVLEDYHLVESPDVHDQLAYLLEHAPPQLHVAVSTRVDPPLPLARMRVRGELT
FT                   EIRAADLRFTAAEADTYLNGLMQLGLTQPQVTALGSRAEGWIAALQLAALSMQGRDDVA
FT                   AFIADFTGDDRYIVDYLAEEVLARQPEQTRRFLLHTAVLDRLTGALCDALTGRDDGRRT
FT                   LEQLERANMFLVALDNQRRWYRYHHLFADVLRARLLDQQPTLIPQLHLAASRWYADDQQ
FT                   PEDAIRHALAGSHMDLAADLIEQAIEQSLRERTEATMRGWLKQLPPDVVAARPALGIAL
FT                   AGATLATGETAGVAQLLNQAEQRLNAPGDAHADTTGRLPGWVEVYRSGLAQAQHDTRGT
FT                   LTHARLALQRLDAGDSTGRAAASALVGLASWATGNLQGAHEAYTAAQSAFKATGYLTDV
FT                   LGCAVVLADIRKTQGRLQSALDTHLEALQYVTTKLHAAEPTQTPPRQGPADTGAAELTG
FT                   LRGIVDTYIGIADIHRERGNPTEATRLLRLAESAGESAGLPQAQYRRHVVQAQIARADG
FT                   DLETADQLLQNAQRLYVADFHPDVIPVAATRARLWVAQGRLDGVFAWARGRALALSDEP
FT                   AFTTEYEHLTLVRAHLAHLSADLSAHLRHHHAADGHPAGDPNRAPGVDQVLGFLDRLLT
FT                   HAEAGGRTGTVIDALIQRAIALRLAAGSRGNRPGQGTDESLRTFHRALDLAEPQGYART
FT                   FLDEGSVVTDLLRDALRAGLNSEYVTALLNQQPHSTTPDLTGTVAPTDAGPQTDRRMEV
FT                   VVERLSQRELDVLRLLATDLSGPDIARHLVVSLNTIRTHTKNLYAKLGVTNRRAAVRRA
FT                   EELHLLQGTVPRRA"
     MRSPILHTKL YAARVRGRTV PRPRLTEHLT DFLSGGRLLL ISAPAGFGKT TTLAQWVQTL        60
     SADAATGDRT GTGPAPGQDT GSRGPGDPAV AQTTNPPAVV AWLSLDPADN EPGRFCAYVL       120
     TAFQHASPGL GADQLHRLEQ QAPATTAADA TPMIAELLND IADLPHDVVL VLEDYHLVES       180
     PDVHDQLAYL LEHAPPQLHV AVSTRVDPPL PLARMRVRGE LTEIRAADLR FTAAEADTYL       240
     NGLMQLGLTQ PQVTALGSRA EGWIAALQLA ALSMQGRDDV AAFIADFTGD DRYIVDYLAE       300
     EVLARQPEQT RRFLLHTAVL DRLTGALCDA LTGRDDGRRT LEQLERANMF LVALDNQRRW       360
     YRYHHLFADV LRARLLDQQP TLIPQLHLAA SRWYADDQQP EDAIRHALAG SHMDLAADLI       420
     EQAIEQSLRE RTEATMRGWL KQLPPDVVAA RPALGIALAG ATLATGETAG VAQLLNQAEQ       480
     RLNAPGDAHA DTTGRLPGWV EVYRSGLAQA QHDTRGTLTH ARLALQRLDA GDSTGRAAAS       540
     ALVGLASWAT GNLQGAHEAY TAAQSAFKAT GYLTDVLGCA VVLADIRKTQ GRLQSALDTH       600
     LEALQYVTTK LHAAEPTQTP PRQGPADTGA AELTGLRGIV DTYIGIADIH RERGNPTEAT       660
     RLLRLAESAG ESAGLPQAQY RRHVVQAQIA RADGDLETAD QLLQNAQRLY VADFHPDVIP       720
     VAATRARLWV AQGRLDGVFA WARGRALALS DEPAFTTEYE HLTLVRAHLA HLSADLSAHL       780
     RHHHAADGHP AGDPNRAPGV DQVLGFLDRL LTHAEAGGRT GTVIDALIQR AIALRLAAGS       840
     RGNRPGQGTD ESLRTFHRAL DLAEPQGYAR TFLDEGSVVT DLLRDALRAG LNSEYVTALL       900
     NQQPHSTTPD LTGTVAPTDA GPQTDRRMEV VVERLSQREL DVLRLLATDL SGPDIARHLV       960
     VSLNTIRTHT KNLYAKLGVT NRRAAVRRAE ELHLLQGTVP RRA                        1003
//

If you have problems or comments...

PBIL Back to PBIL home page