(data stored in ACNUC30630 zone)

EMBL: CP001737.PE407

CP001737.PE407       Location/Qualifiers
FT   CDS             complement(459902..460693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0424"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   atc:AGR_L_50 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76845"
FT                   /db_xref="GOA:C8X674"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C8X674"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACV76845.1"
FT                   /translation="MTAPIRRRRGLTEQAASAAIDTACRQLRLPTVRGLVTDMVTVAEK
FT                   EQLTYQGFLAELLLAECDDRARRRSVRRVKAAGFPREKWLADFDFDANPNINSATIHTL
FT                   AGCGWIRAGQPLCLIGDSGTGKSHLLIGLGTAAAENGFRVKYTLATKLVNELVEAADDK
FT                   ILAKTIARYGRVDLLCIDELGYMELDKRGAELLFQVLTEREEKNSVAIASNDSFSGWTK
FT                   TFTDARLCAAIVDRLTFGGNIIETGTDSYRLARTKAQQAAS"
     MTAPIRRRRG LTEQAASAAI DTACRQLRLP TVRGLVTDMV TVAEKEQLTY QGFLAELLLA        60
     ECDDRARRRS VRRVKAAGFP REKWLADFDF DANPNINSAT IHTLAGCGWI RAGQPLCLIG       120
     DSGTGKSHLL IGLGTAAAEN GFRVKYTLAT KLVNELVEAA DDKILAKTIA RYGRVDLLCI       180
     DELGYMELDK RGAELLFQVL TEREEKNSVA IASNDSFSGW TKTFTDARLC AAIVDRLTFG       240
     GNIIETGTDS YRLARTKAQQ AAS                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page