(data stored in ACNUC30630 zone)

EMBL: CP001737.PE408

CP001737.PE408       Location/Qualifiers
FT   CDS             complement(461208..462596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0426"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   bvi:Bcep1808_0454 transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76846"
FT                   /db_xref="GOA:C8X675"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C8X675"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACV76846.1"
FT                   /translation="MTMTEQSSSVPSSPVDDEVPGPARSTGRQLRELLADDVWLDELID
FT                   RAEAGGVRLTGEGGFLPEMIKAVLERGLAAELTGHLGYEAGDPAGRGSPNSRNGHTPKT
FT                   LSTEVGPVPLSVPRDRKSTFEPRLVPKGQRRLGGLDEQIISLYAGGMTVRDIQAHLART
FT                   LGTELSHDTISKITDAVLEEVKAWQSRPLEELYPIMYLDAIVVKVRDGHQVRNKSAYIA
FT                   VGVDMAGIKHVLGIWVQSTEGAKFWAGVCAELANRGVKDVLIVCCDGLTGLPEAIEATW
FT                   PRTTVQTCVVHLIRASMRFVSYTDRRAVVAQLKTIYTAPTVDAAETALLTFAETDLARR
FT                   YPACLRTWQDAWDRFIPFLAFPWPVRKIIYTTNAIESLNYQLRKIIKNRGHFPNDDAVV
FT                   KLLWLAIRDIEDKRARDRAAEKGKRVGRTAEGRLVEGQVTTGWKPALGALAIQYPDRIT
FT                   PRIS"
     MTMTEQSSSV PSSPVDDEVP GPARSTGRQL RELLADDVWL DELIDRAEAG GVRLTGEGGF        60
     LPEMIKAVLE RGLAAELTGH LGYEAGDPAG RGSPNSRNGH TPKTLSTEVG PVPLSVPRDR       120
     KSTFEPRLVP KGQRRLGGLD EQIISLYAGG MTVRDIQAHL ARTLGTELSH DTISKITDAV       180
     LEEVKAWQSR PLEELYPIMY LDAIVVKVRD GHQVRNKSAY IAVGVDMAGI KHVLGIWVQS       240
     TEGAKFWAGV CAELANRGVK DVLIVCCDGL TGLPEAIEAT WPRTTVQTCV VHLIRASMRF       300
     VSYTDRRAVV AQLKTIYTAP TVDAAETALL TFAETDLARR YPACLRTWQD AWDRFIPFLA       360
     FPWPVRKIIY TTNAIESLNY QLRKIIKNRG HFPNDDAVVK LLWLAIRDIE DKRARDRAAE       420
     KGKRVGRTAE GRLVEGQVTT GWKPALGALA IQYPDRITPR IS                          462
//

If you have problems or comments...

PBIL Back to PBIL home page