(data stored in ACNUC30630 zone)

EMBL: CP001737.PE418

CP001737.PE418       Location/Qualifiers
FT   CDS             complement(473974..474771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0436"
FT                   /product="FRG domain protein"
FT                   /note="PFAM: FRG domain protein; KEGG: ppd:Ppro_2571
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76856"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:C8X685"
FT                   /inference="protein motif:PFAM:PF08867"
FT                   /protein_id="ACV76856.1"
FT                   /translation="MTIPTITPASWSELHDVLFDEPWPVHAGEFHSGLIHRGMTDYSWP
FT                   LMSSLDRLKLFTMEQHLLRNFQKYARLANFSPDRTWEWLAVAQHHGLPTRLMDWTYSPL
FT                   VALHFAIANPAYPRSSVVWSLDYVRVHSRLPTMVRSAIRGDAAAFTTDMLDRASIPVWP
FT                   KDWQELTDAYMVILEPPSIDDRIVNQYAGLSAFSSTKVAIEDWLATFSEPVALKIEVLP
FT                   HLKAEIREKLDKANINERVIYPGLDGLATWLTRYYSTPARTWI"
     MTIPTITPAS WSELHDVLFD EPWPVHAGEF HSGLIHRGMT DYSWPLMSSL DRLKLFTMEQ        60
     HLLRNFQKYA RLANFSPDRT WEWLAVAQHH GLPTRLMDWT YSPLVALHFA IANPAYPRSS       120
     VVWSLDYVRV HSRLPTMVRS AIRGDAAAFT TDMLDRASIP VWPKDWQELT DAYMVILEPP       180
     SIDDRIVNQY AGLSAFSSTK VAIEDWLATF SEPVALKIEV LPHLKAEIRE KLDKANINER       240
     VIYPGLDGLA TWLTRYYSTP ARTWI                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page