(data stored in ACNUC30630 zone)

EMBL: CP001737.PE422

CP001737.PE422       Location/Qualifiers
FT   CDS             477990..479168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0440"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76860"
FT                   /db_xref="GOA:C8X689"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C8X689"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ACV76860.1"
FT                   /translation="MISTVRRVQLIAPATVTLLVAMAAVVTVAAVAQPNPSVAVPGGSG
FT                   CVPVTGSTGGVLAAAQERNAKVVIGVALARGLGSTGAAIGVSVALAESTLFNYANDGTS
FT                   TLVGSAEGRQLTDAERAVARQSLAFPHDRVGNNLDSIGLFQQRPMTGWGTPAELIDPAI
FT                   AAGKFYDRLVQVPGWQGMPPWNAAQTVQGSPSSDGGIYRDMYTQATGIVANLTTDTGGT
FT                   SATVAPVAAAVGPGCGSAEVAHVAVTGGGGSAAWGGYQNGRIPAAALCPVPSAPGLLLE
FT                   CRAAAAFDELNAAFRAVFGQDIGITDGYRSYQEQVACRAEKGSLCADPGTSNHGWAKAV
FT                   DIGACCGVNTGSGAAFDWLTANAGAFGWVHPPWAQPGGSKPEPWHWEYGAIS"
     MISTVRRVQL IAPATVTLLV AMAAVVTVAA VAQPNPSVAV PGGSGCVPVT GSTGGVLAAA        60
     QERNAKVVIG VALARGLGST GAAIGVSVAL AESTLFNYAN DGTSTLVGSA EGRQLTDAER       120
     AVARQSLAFP HDRVGNNLDS IGLFQQRPMT GWGTPAELID PAIAAGKFYD RLVQVPGWQG       180
     MPPWNAAQTV QGSPSSDGGI YRDMYTQATG IVANLTTDTG GTSATVAPVA AAVGPGCGSA       240
     EVAHVAVTGG GGSAAWGGYQ NGRIPAAALC PVPSAPGLLL ECRAAAAFDE LNAAFRAVFG       300
     QDIGITDGYR SYQEQVACRA EKGSLCADPG TSNHGWAKAV DIGACCGVNT GSGAAFDWLT       360
     ANAGAFGWVH PPWAQPGGSK PEPWHWEYGA IS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page