(data stored in ACNUC30630 zone)

EMBL: CP001737.PE423

CP001737.PE423       Location/Qualifiers
FT   CDS             479165..479908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76861"
FT                   /db_xref="GOA:C8X690"
FT                   /db_xref="UniProtKB/TrEMBL:C8X690"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76861.1"
FT                   /translation="MNWQPQSGTEAITGWINQGVLFALVLAVAAVVVCAATWAVGSLAA
FT                   NGAVVARARTGVAVSLAAALLLGGGVTWVHWTDTQAAAFAGDPKDYGIEDAPQTPAQWE
FT                   VLDLSEWWTGNINTIRARDGLPPLATDGGLAERARSCASSRAGQGGDCPRNYFSCRQDT
FT                   GMVYAAWDYGPGDLDKLNQDLAEAFIRSPNPWGGDDTHRTLDPSTDMRSAWVALRDNAN
FT                   KKAVVVALLENRAGLAEWNECGTFQ"
     MNWQPQSGTE AITGWINQGV LFALVLAVAA VVVCAATWAV GSLAANGAVV ARARTGVAVS        60
     LAAALLLGGG VTWVHWTDTQ AAAFAGDPKD YGIEDAPQTP AQWEVLDLSE WWTGNINTIR       120
     ARDGLPPLAT DGGLAERARS CASSRAGQGG DCPRNYFSCR QDTGMVYAAW DYGPGDLDKL       180
     NQDLAEAFIR SPNPWGGDDT HRTLDPSTDM RSAWVALRDN ANKKAVVVAL LENRAGLAEW       240
     NECGTFQ                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page