(data stored in ACNUC30630 zone)

EMBL: CP001737.PE430

CP001737.PE430       Location/Qualifiers
FT   CDS             complement(485736..486332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76868"
FT                   /db_xref="UniProtKB/TrEMBL:C8X697"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76868.1"
FT                   /translation="MSVHHGRDPIAAAVRRATQTRAEKPPSAGQQIMATVDIAGEQDLR
FT                   VDTHGSGNRKDWGGHIAVSTDNLLIYLHDQLAARQYAVAWIDAWYNASRLPKTVTTGPS
FT                   DHGPVMMVRAHGTDTVDHVFDATQNLAIIRIGGLTWRIHDQAAWATTERKWREVSALAP
FT                   LVLPVNRYQAAKPRPTKDHEQRPAWAEIRGPRPTL"
     MSVHHGRDPI AAAVRRATQT RAEKPPSAGQ QIMATVDIAG EQDLRVDTHG SGNRKDWGGH        60
     IAVSTDNLLI YLHDQLAARQ YAVAWIDAWY NASRLPKTVT TGPSDHGPVM MVRAHGTDTV       120
     DHVFDATQNL AIIRIGGLTW RIHDQAAWAT TERKWREVSA LAPLVLPVNR YQAAKPRPTK       180
     DHEQRPAWAE IRGPRPTL                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page