(data stored in ACNUC30630 zone)

EMBL: CP001737.PE434

CP001737.PE434       Location/Qualifiers
FT   CDS             487778..489643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0452"
FT                   /product="Type IV secretory pathway VirD4 protein-like
FT                   protein"
FT                   /note="KEGG: rle:pRL100217 putative conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76872"
FT                   /db_xref="GOA:C8X6A1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6A1"
FT                   /inference="protein motif:COG:COG3505"
FT                   /protein_id="ACV76872.1"
FT                   /translation="MLTSKTKTPHRSADIDRLLVGVVLLVGVGGLLLWVGGQAASLLTG
FT                   NGFAAGPVTAGARALLADRDNPSAAWDSPMPDPAAYWWITATVTGLLLALGALGAVGFA
FT                   KVRGRVRLRGRLSEMATRPGMATSRDIKATVGPKRLRRSAPELRPTLAGRIGPRELGWC
FT                   WGTARGVGVWTSVRDSVVLLGPSGAGKGVYVVNNRILDAPGAVVATSTRPDVLSVTITH
FT                   RRNAGPVAVIATDGSMDGLPEIVRWSPIQECRDGRVAAARAQVLAAGSSSGVEDASFWQ
FT                   GWTEKVIKTLLHAAAWSGTGIDDLWRWSQSAVAARSALAVLQDLDGRDTGTGQRVEPGW
FT                   ADTLAQVVEGDDKFRGNLWAGVGKALAGLDLYSVRRRFDPRPGENFDPTAFLADRGTLY
FT                   LLAEADDPASRLLQCLVADITRTAKDLADHSPKSRLDPPLTLVLDEIANWAPLPALPTY
FT                   VSAYGGSGVVTIAVIQSRAQMARSWGSDAAKAIWDSATITGILGGVTDAENLRDFAAIA
FT                   GDRDETSWQASTGKDGGLLGLGSGRSYSEQTRTRAVLTTGEIRGLPEGTMLMFYKGLDP
FT                   MLVRMTAYYRRKERKTLLAGRAAIEARISETAAAGPVVAEPAEET"
     MLTSKTKTPH RSADIDRLLV GVVLLVGVGG LLLWVGGQAA SLLTGNGFAA GPVTAGARAL        60
     LADRDNPSAA WDSPMPDPAA YWWITATVTG LLLALGALGA VGFAKVRGRV RLRGRLSEMA       120
     TRPGMATSRD IKATVGPKRL RRSAPELRPT LAGRIGPREL GWCWGTARGV GVWTSVRDSV       180
     VLLGPSGAGK GVYVVNNRIL DAPGAVVATS TRPDVLSVTI THRRNAGPVA VIATDGSMDG       240
     LPEIVRWSPI QECRDGRVAA ARAQVLAAGS SSGVEDASFW QGWTEKVIKT LLHAAAWSGT       300
     GIDDLWRWSQ SAVAARSALA VLQDLDGRDT GTGQRVEPGW ADTLAQVVEG DDKFRGNLWA       360
     GVGKALAGLD LYSVRRRFDP RPGENFDPTA FLADRGTLYL LAEADDPASR LLQCLVADIT       420
     RTAKDLADHS PKSRLDPPLT LVLDEIANWA PLPALPTYVS AYGGSGVVTI AVIQSRAQMA       480
     RSWGSDAAKA IWDSATITGI LGGVTDAENL RDFAAIAGDR DETSWQASTG KDGGLLGLGS       540
     GRSYSEQTRT RAVLTTGEIR GLPEGTMLMF YKGLDPMLVR MTAYYRRKER KTLLAGRAAI       600
     EARISETAAA GPVVAEPAEE T                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page