(data stored in ACNUC30630 zone)

EMBL: CP001737.PE44

CP001737.PE44        Location/Qualifiers
FT   CDS             52369..53544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0044"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bpa:BPP4114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76482"
FT                   /db_xref="GOA:C8XHZ1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ1"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACV76482.1"
FT                   /translation="MDVPSPTDRPGPLAGIVVADFSRVLAGPYATMLLADLGADVIKVE
FT                   GPGGDDTRSWVPPTRDDVGTYYLAVNRNKRSVVLDLKDTGDRALAHELSARADVFIQNF
FT                   KPGGLARFGLDYESVRGRNERIIYCSISGFGADKGANLPGYDLLVQGMSGLMSLTGAPD
FT                   GPPFRSGISVFDVMTGLHSVIGVLAALHHRDLTGQGQHIETNLLSSALSALVNQSSAYV
FT                   AGGVVPARMGNAHLSLFPYEPLATGDGELIVVAGNDGQFRRLAETIGRPELADDPRFDT
FT                   VGRRNDNREQLRPLLLEALSARTAQEWFGLFTAAGLPSGPINTVQGGVELAESLGLQPV
FT                   VQVGEAQVPSVRNPIRLSATPPDYRYAPPALDEQGEELRRWLREPRRGSDG"
     MDVPSPTDRP GPLAGIVVAD FSRVLAGPYA TMLLADLGAD VIKVEGPGGD DTRSWVPPTR        60
     DDVGTYYLAV NRNKRSVVLD LKDTGDRALA HELSARADVF IQNFKPGGLA RFGLDYESVR       120
     GRNERIIYCS ISGFGADKGA NLPGYDLLVQ GMSGLMSLTG APDGPPFRSG ISVFDVMTGL       180
     HSVIGVLAAL HHRDLTGQGQ HIETNLLSSA LSALVNQSSA YVAGGVVPAR MGNAHLSLFP       240
     YEPLATGDGE LIVVAGNDGQ FRRLAETIGR PELADDPRFD TVGRRNDNRE QLRPLLLEAL       300
     SARTAQEWFG LFTAAGLPSG PINTVQGGVE LAESLGLQPV VQVGEAQVPS VRNPIRLSAT       360
     PPDYRYAPPA LDEQGEELRR WLREPRRGSD G                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page