(data stored in ACNUC30630 zone)

EMBL: CP001737.PE445

CP001737.PE445       Location/Qualifiers
FT   CDS             505454..508588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0464"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   bps:BPSL0763 putative helicase SNF2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76883"
FT                   /db_xref="GOA:C8X714"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C8X714"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACV76883.1"
FT                   /translation="MTTTTDVKNELASGRVVQVRGLRWVISDVVPFSSAGSGGRPTSTL
FT                   VELQSVEDDRFNEALSVIWEVEPDARVLPTSSLPDPNEGFDQPQRLAAFLDAVRWGAVA
FT                   SADVNALQAPFRSGVRVEDYQLEPVARALTAPRVNLLLADDVGLGKTIEAGLVAVELLL
FT                   RQRARRIMVICPAGLTVKWRQEMAEKFGREFTVVNSEQCAVLRRTHGSAANPFRVYPLT
FT                   IVSLPWLRSPRGQRLLDEVLPVEGPADTREFDLLILDEAHHVAPAAPKQRYAVDSQQTK
FT                   LIRRLAPHFEHRLFLTATPHNGYPESFEALLELVDNQRFARGVPPDRQAQREVVIRRLK
FT                   TEILEPDGSKRFRQRRTEPLPVQYPEDERQGHALLTEFAAARGIRLKTNRRGRRAADLV
FT                   TLLFKKRLFSSPAAFGRTVAVYRENQLAGSPSASSDAEPAWMDDFLGDIADLDDEDMAD
FT                   EEDDAVRRATVLQGGPSDTELELLERLRLWAEAHTPNPDAKASELLTYLRAVCHPDRDW
FT                   TNERVVVFTEYRDTQDWLVRLLQQDGLGAGVRVLHGGMNPVERENLRQAFQADPTEDPV
FT                   RILIATDAASEGIDLHWQCHRLINYDIPFNPNKLEQRIGRIDRYGQRFDPEVFHFVGTG
FT                   FGRAVDTYEADLEFLARVAEKVARMEEDLGAVNAVLADAVQRRMLGQHVDLDHAVEEPR
FT                   RTRKGRVASDADIAGQVQRLHDQLTDSVAALNLNPQSLKRVVDTALALSHQQSLTRAND
FT                   PDPVWDVPALTGTWEITTRDLPHPLRPDQRRPVTFDPEIAARRREDVVFAHLGHPLVTR
FT                   ATRLLRAAVTSTDIDLHRVAAVLSDDPGLEDTLAVSYARFLVVGGDGARLHEEVLHAGG
FT                   WVRPDGRFARVESFARLDAQLTAALAQGRSAPRQWTNRLAAGWSATQRGLFLALERRAA
FT                   NRRTTVGNLLDRRSQAEEDRITTNLDSFAKSLRQRLSEADDEGTEVGLFARHLADPNEA
FT                   AQFRRDRQSWEERLDRLPAERDAEISRIAARYAQPADHLFPVAVIFVVPTRLVTR"
     MTTTTDVKNE LASGRVVQVR GLRWVISDVV PFSSAGSGGR PTSTLVELQS VEDDRFNEAL        60
     SVIWEVEPDA RVLPTSSLPD PNEGFDQPQR LAAFLDAVRW GAVASADVNA LQAPFRSGVR       120
     VEDYQLEPVA RALTAPRVNL LLADDVGLGK TIEAGLVAVE LLLRQRARRI MVICPAGLTV       180
     KWRQEMAEKF GREFTVVNSE QCAVLRRTHG SAANPFRVYP LTIVSLPWLR SPRGQRLLDE       240
     VLPVEGPADT REFDLLILDE AHHVAPAAPK QRYAVDSQQT KLIRRLAPHF EHRLFLTATP       300
     HNGYPESFEA LLELVDNQRF ARGVPPDRQA QREVVIRRLK TEILEPDGSK RFRQRRTEPL       360
     PVQYPEDERQ GHALLTEFAA ARGIRLKTNR RGRRAADLVT LLFKKRLFSS PAAFGRTVAV       420
     YRENQLAGSP SASSDAEPAW MDDFLGDIAD LDDEDMADEE DDAVRRATVL QGGPSDTELE       480
     LLERLRLWAE AHTPNPDAKA SELLTYLRAV CHPDRDWTNE RVVVFTEYRD TQDWLVRLLQ       540
     QDGLGAGVRV LHGGMNPVER ENLRQAFQAD PTEDPVRILI ATDAASEGID LHWQCHRLIN       600
     YDIPFNPNKL EQRIGRIDRY GQRFDPEVFH FVGTGFGRAV DTYEADLEFL ARVAEKVARM       660
     EEDLGAVNAV LADAVQRRML GQHVDLDHAV EEPRRTRKGR VASDADIAGQ VQRLHDQLTD       720
     SVAALNLNPQ SLKRVVDTAL ALSHQQSLTR ANDPDPVWDV PALTGTWEIT TRDLPHPLRP       780
     DQRRPVTFDP EIAARRREDV VFAHLGHPLV TRATRLLRAA VTSTDIDLHR VAAVLSDDPG       840
     LEDTLAVSYA RFLVVGGDGA RLHEEVLHAG GWVRPDGRFA RVESFARLDA QLTAALAQGR       900
     SAPRQWTNRL AAGWSATQRG LFLALERRAA NRRTTVGNLL DRRSQAEEDR ITTNLDSFAK       960
     SLRQRLSEAD DEGTEVGLFA RHLADPNEAA QFRRDRQSWE ERLDRLPAER DAEISRIAAR      1020
     YAQPADHLFP VAVIFVVPTR LVTR                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page