(data stored in ACNUC30630 zone)

EMBL: CP001737.PE451

CP001737.PE451       Location/Qualifiers
FT   CDS             520863..521621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76889"
FT                   /db_xref="GOA:C8X720"
FT                   /db_xref="UniProtKB/TrEMBL:C8X720"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76889.1"
FT                   /translation="MNLREELAYMQRIVISWNLLAEAARRHPSGEIAHDWHHWYDSLQF
FT                   VIDSEHAILCNRAGGIHLLTPGNFGPWEPRPSGDGWGYAQTQGIRKTVRDFENVIGLPS
FT                   PKHTPKTTERTLVYRILAAICSISMIHGVLLDPRPGMIYDSNDYGSGIEEDQFSLFPLA
FT                   LKLLDGRGPDRRVDASKDFWFLVPRTLGSSESEAKGQALGVLHTSGQLWTRNGAEISLV
FT                   TRYDEISREFALLAGETFAVVTQESELFQT"
     MNLREELAYM QRIVISWNLL AEAARRHPSG EIAHDWHHWY DSLQFVIDSE HAILCNRAGG        60
     IHLLTPGNFG PWEPRPSGDG WGYAQTQGIR KTVRDFENVI GLPSPKHTPK TTERTLVYRI       120
     LAAICSISMI HGVLLDPRPG MIYDSNDYGS GIEEDQFSLF PLALKLLDGR GPDRRVDASK       180
     DFWFLVPRTL GSSESEAKGQ ALGVLHTSGQ LWTRNGAEIS LVTRYDEISR EFALLAGETF       240
     AVVTQESELF QT                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page