(data stored in ACNUC30630 zone)

EMBL: CP001737.PE452

CP001737.PE452       Location/Qualifiers
FT   CDS             complement(521980..522606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X721"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76890.1"
FT                   /translation="MNAEWVSCIVGDLAKDPTLVQRGDLIQYELWETPDGPARYRALIK
FT                   VAEVTPGSQVRIAGWEDTTYFDRDGAVTSTYSGYGSVFAARWDPIRVLRGGAPEIFEGE
FT                   RVDEVRAALDSYAAGNASFDDVKATVDTAVFSIGIGPGRNLEEVHRRAEEAPLTEPNTF
FT                   DQVLWLPLLSKQITLDQRGELFELAHFTNGGGGRPRRPSSDQPDE"
     MNAEWVSCIV GDLAKDPTLV QRGDLIQYEL WETPDGPARY RALIKVAEVT PGSQVRIAGW        60
     EDTTYFDRDG AVTSTYSGYG SVFAARWDPI RVLRGGAPEI FEGERVDEVR AALDSYAAGN       120
     ASFDDVKATV DTAVFSIGIG PGRNLEEVHR RAEEAPLTEP NTFDQVLWLP LLSKQITLDQ       180
     RGELFELAHF TNGGGGRPRR PSSDQPDE                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page