(data stored in ACNUC30630 zone)

EMBL: CP001737.PE456

CP001737.PE456       Location/Qualifiers
FT   CDS             525622..525801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0475"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76894"
FT                   /db_xref="GOA:C8X725"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C8X725"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACV76894.1"
FT                   /translation="MDRVLLTAEEAADCLKVGRCKVYDLIRTGELQSIKIGRLRRIPVD
FT                   AVREFASKILADAD"
     MDRVLLTAEE AADCLKVGRC KVYDLIRTGE LQSIKIGRLR RIPVDAVREF ASKILADAD         59
//

If you have problems or comments...

PBIL Back to PBIL home page